DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and C14E2.4

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:197 Identity:45/197 - (22%)
Similarity:79/197 - (40%) Gaps:21/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 VKLEQLNIEPFVGLFHDAISPAEQKDLLHLTDS-RLEHRK--KDSSSVEAKVDTNASDHVRRIHQ 329
            |::|.|:..|.:.::.|..|..:..|.|.|..: ::..:|  :|...:.......|:..:...|.
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHS 145

  Fly   330 RIED----------ITGFDLEESEPLTVSNYGIGGQDFIHLD------CEQPKEFIGYYPKEYRS 378
            ..|.          :..||.:.:|.::..:|..||...:|.|      .|......|....  |.
 Worm   146 HAEAQSLMDTATQLLPVFDFQYTEQISALSYIKGGHYALHTDFLTFANAEDSNRHFGEMGN--RL 208

  Fly   379 ASAMFYLSDVQMGGYASFPDLGFGFKPRRGSALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKK 443
            |:.:......:.||...||.||..|:...|.|.:|.|.:.:...:.:||...||:..|.:.:|..
 Worm   209 ATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNLEREAKSLHGGCPIRAGEKIIATI 273

  Fly   444 WI 445
            ||
 Worm   274 WI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 38/176 (22%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 40/178 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.