DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and DYRK1B

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_004705.1 Gene:DYRK1B / 9149 HGNCID:3092 Length:629 Species:Homo sapiens


Alignment Length:456 Identity:126/456 - (27%)
Similarity:197/456 - (43%) Gaps:96/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1644 QHQPHQQQQNEMSKSALGLHFIETAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVK 1708
            |..|.|...|:..|..|...:         ||.:...|..:|:....||:|.:.:|:|:||:|||
Human    72 QQAPPQDSSNKKEKKVLNHGY---------DDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVK 127

  Fly  1709 VKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEM 1773
            ..|.:....:|:|||||.:.:...|::|:..||.:.|.|....:..|.:...|.:..|:|:|||:
Human   128 AYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFEL 192

  Fly  1774 LGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLT--HTDLKPENILFVDSDYTSHYN 1836
            |..:::|.||..::....|:..|.:|.|||.::.||....|:  |.||||||||..:.       
Human   193 LSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNP------- 250

  Fly  1837 HKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFE 1901
                      |.:.::::||||:....:.....:.:|.||:|||:|...:....|:||:||||.|
Human   251 ----------KRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVE 305

  Fly  1902 LYLGITLFQTHDNREHLAMMERILGQIPYRM------ARNH---------TLYSKTKTKYFYHGK 1951
            ::.|..||...:..:.:..:..:||..|..|      ||.:         ||....:.:..|.|.
Human   306 MHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRTKELRKDYQGP 370

  Fly  1952 --------LDWDEKSSAGRYVRD--HCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEA 2006
                    |........||...:  |          ...|:.....|:.:||||||::||:...|
Human   371 GTRRLQEVLGVQTGGPGGRRAGEPGH----------SPADYLRFQDLVLRMLEYEPAARISPLGA 425

  Fly  2007 LHHPFFDRLPPHHRVGEVSNKQPL----------------------------SSGSSSRERSHSL 2043
            |.|.||.|     ...|.:|..|.                            ||||||..|::..
Human   426 LQHGFFRR-----TADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRY 485

  Fly  2044 S 2044
            |
Human   486 S 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 104/359 (29%)
S_TKc 1692..2012 CDD:214567 101/346 (29%)
DYRK1BNP_004705.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..89 5/16 (31%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 69..86 4/13 (31%)
PKc_DYRK1 97..436 CDD:271128 107/370 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..399 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..629 11/51 (22%)
Interaction with RANBP9. /evidence=ECO:0000269|PubMed:14500717 480..520 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.