DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and DYRK3

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_003573.2 Gene:DYRK3 / 8444 HGNCID:3094 Length:588 Species:Homo sapiens


Alignment Length:648 Identity:161/648 - (24%)
Similarity:263/648 - (40%) Gaps:181/648 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1454 PPGMMPQMYGYQAPQQQSKIG---------YPRTGAPLTHSASFSSAQRP-------TALQFHQQ 1502
            |||.       ..|.||.::|         ...|..|...:...:.::.|       |..||...
Human    15 PPGA-------GLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGD 72

  Fly  1503 HQQQQHLQQQQQHPQQQQHQHSSFGVGMMSRNYYNMPKQPERKPLQTFDPYAYPKPNQMQPVKYQ 1567
            |.                 ||...|              .|.|..|.|..:...|.|.:|.....
Human    73 HT-----------------QHFLDG--------------GEMKVEQLFQEFGNRKSNTIQSDGIS 106

  Fly  1568 QQQQHPHTQFQNASAGGGGGGAAGLQYDPNTNTQLFYASPASSSSNKQPQ----QPQQQQQQQQS 1628
            ..::...|..|..|:             ...||      ..|:||:|.|:    .|:|..:|.:.
Human   107 DSEKCSPTVSQGKSS-------------DCLNT------VKSNSSSKAPKVVPLTPEQALKQYKH 152

  Fly  1629 QLQQSNSV-IFNHSGQQHQPHQQQQNEMSKSALGLHFI-ETAKP---VI-------QDDADGHLI 1681
            .|.....: |.|:      |.             ::|: ..||.   ||       .|||||..|
Human   153 HLTAYEKLEIINY------PE-------------IYFVGPNAKKRHGVIGGPNNGGYDDADGAYI 198

  Fly  1682 YHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQK 1746
            :...|.|.:||:::..:|:|:||:|.:|.|.:....:|||:::|.:::...|..||..||.:.::
Human   199 HVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQ 263

  Fly  1747 DPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHD 1811
            |.......:.|::.|.:..|:|:.||:|.:.:::.:::|.::.:.:..||..|..:..|:..||.
Human   264 DKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHK 328

  Fly  1812 NRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYR 1876
            |::.|.||||||||.      .|:.           .:..::|||||:.|:::...|.:.:|.||
Human   329 NKIIHCDLKPENILL------KHHG-----------RSSTKVIDFGSSCFEYQKLYTYIQSRFYR 376

  Fly  1877 APEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSK 1941
            |||:||...:|.|.|:||.||||.||..|..||...|..:.||.|..:||..|.::     |...
Human   377 APEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKL-----LEQS 436

  Fly  1942 TKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSED------------------------- 1981
            .:.|||.:.|       ...||          |.::...|                         
Human   437 KRAKYFINSK-------GIPRY----------CSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWG 484

  Fly  1982 ----HCE--LF-SLIKKMLEYEPSSRITLGEALHHPFFDRLPPH--HRVGEVSNKQPLSSGSS 2035
                .|:  || ..:|:.|.::||:|:|..:||.||:..:..|.  ..:.:||.|:.::..|:
Human   485 TALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASA 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 105/364 (29%)
S_TKc 1692..2012 CDD:214567 101/351 (29%)
DYRK3NP_003573.2 Disordered. /evidence=ECO:0000305|PubMed:23415227 1..188 46/248 (19%)
PKc_DYRK2_3 143..522 CDD:271126 122/436 (28%)
S_TKc 209..522 CDD:214567 101/351 (29%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:29973724 468..481 0/12 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.