DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and AT1G13350

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_001321965.1 Gene:AT1G13350 / 837895 AraportID:AT1G13350 Length:834 Species:Arabidopsis thaliana


Alignment Length:480 Identity:141/480 - (29%)
Similarity:213/480 - (44%) Gaps:93/480 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1580 ASAGGGGGGAAGLQYDPNTNTQLFYASPASSSSNKQPQQPQQQQQQQQSQLQQSNSVI---FNHS 1641
            ||.|.|.|.......|......:|..|||.|             |:....|.|...::   |::|
plant   396 ASTGLGEGSPKDKISDDMFTDDIFGESPADS-------------QKMVCTLTQIIDLVFIEFSNS 447

  Fly  1642 G------QQHQPHQQQQNEMSKSALGLHFIE-----------TAKPVIQ-------DDADGHLIY 1682
            |      ..|...:..:|       ||.|:.           ...|:::       |||:|:..|
plant   448 GFICFVFPVHHLTRYSRN-------GLPFVHYIFVGYLRGKGNGIPIVRSGLDDNWDDAEGYYSY 505

  Fly  1683 HTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC----MALKIIKNVEKYREAAKLEINALEKI 1743
            ..|::|..||:||||.|:|.|..||:.||.:.:..    :|:|||:|.|...:|.:.||..|:|:
plant   506 QLGELLDDRYEIMATHGKGVFSTVVRAKDTKAELGEPEEVAIKIIRNNETMHKAGQTEIQILKKL 570

  Fly  1744 AQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYE-PYPLDQVRHMAYQLCYSVK 1807
            |..||.....||:.:..|.|..|:|:|||.|.|::.:.:::.... ...|..||..|.||..|:|
plant   571 AGSDPENKRHCVRFLSTFKYRNHLCLVFESLHLNLREIVKKYGRNIGIQLSGVRVYATQLFISLK 635

  Fly  1808 FLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHST--IV 1870
            .|.:..:.|.|:||:|:|                 |...:|| ::|.|||||.|...:..|  :|
plant   636 HLKNCGVLHCDIKPDNML-----------------VNEGRNT-LKLCDFGSAMFAGTNEVTPYLV 682

  Fly  1871 STRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARN 1935
            | |.|||||:||.|.:..|.|:||:||.|:||:.|..:|....|.|.|.:...:.|..|.:|.|.
plant   683 S-RFYRAPEIILGLPYDHPLDIWSVGCCLYELFSGKIMFPGSTNNEMLRLHMELKGAFPKKMLRK 746

  Fly  1936 HTLYSK--TKTKYFYHGKLDWDEKSSA------------GRYVRDHCKPLFLCQLSDSEDHCELF 1986
            .....:  .|...||..:.|...:.:.            |..::...|.      .||:......
plant   747 GAFIDQHFDKDLCFYATEEDSVTRKTTKRMMVNIKPKEFGSVIKQRYKD------EDSKLLVHFR 805

  Fly  1987 SLIKKMLEYEPSSRITLGEALHHPF 2011
            .|:.::...:|..|||:.:||.|||
plant   806 DLLDRIFILDPQKRITVSQALAHPF 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 114/354 (32%)
S_TKc 1692..2012 CDD:214567 110/341 (32%)
AT1G13350NP_001321965.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.