DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and YAK1

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_198447.2 Gene:YAK1 / 833590 AraportID:AT5G35980 Length:956 Species:Arabidopsis thaliana


Alignment Length:372 Identity:104/372 - (27%)
Similarity:177/372 - (47%) Gaps:70/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1691 RYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQK-DPHCDHLC 1754
            ||.:...||.||||:|.|....|.:..:|:|:|||...|.:.|.:|::.|..:.:| ||...:..
plant   121 RYIVKDLLGHGTFGQVAKCWVPETNSFVAVKVIKNQLAYYQQALVEVSILTTLNKKYDPEDKNHI 185

  Fly  1755 VKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDL 1819
            |::.|:|.:..|:||.||:|.:::::.::.|.:....|..|:..:.|:...:..|.|..:.|.||
plant   186 VRIYDYFLHQSHLCICFELLDMNLYELIKINQFRGLSLSIVKLFSKQILLGLALLKDAGIIHCDL 250

  Fly  1820 KPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILEL 1884
            ||||||...|                ||.|::::||||||..:.:...:.:.:|:||:|||:|..
plant   251 KPENILLCAS----------------VKPTEIKIIDFGSACMEDKTVYSYIQSRYYRSPEVLLGY 299

  Fly  1885 GWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIP----YRMARN---------- 1935
            .::...|:||.|||:.||:||:.||......:.|..|..|||:.|    .:.|:|          
plant   300 QYTTAIDMWSFGCIVAELFLGLPLFPGGSEFDILRRMIEILGKQPPDYVLKEAKNTNKFFKCVGS 364

  Fly  1936 -HTL-----YSKTKT----------------------KYFYHGKLDWDEKSSAGRYVRDHCKPLF 1972
             |.|     |...|:                      :||.|..|:        ..|:.:...:.
plant   365 VHNLGNGGTYGGLKSAYMALTGEEFEAREKKKPEIGKEYFNHKNLE--------EIVKSYPYKIN 421

  Fly  1973 LCQ---LSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLP 2016
            |.:   :.:::....|...:|.::|::|:.|.:..:|..|||....|
plant   422 LPEDDVVKETQIRLALIDFLKGLMEFDPAKRWSPFQAAKHPFITGEP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 102/366 (28%)
S_TKc 1692..2012 CDD:214567 101/365 (28%)
YAK1NP_198447.2 PKc_YAK1 122..464 CDD:271114 101/365 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.