DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and AT3G53640

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_190932.1 Gene:AT3G53640 / 824532 AraportID:AT3G53640 Length:642 Species:Arabidopsis thaliana


Alignment Length:357 Identity:123/357 - (34%)
Similarity:185/357 - (51%) Gaps:42/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1674 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC----MALKIIKNVEKYREAAK 1734
            |||:|:..|..|::|..||:||||.|:|.|..||:.||.:.:..    :|:|||:..|...:|.:
plant   305 DDAEGYYSYQLGELLDDRYEIMATHGKGVFSTVVRAKDTKPELGEPEEVAIKIIRKNETMHKAGQ 369

  Fly  1735 LEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYE-PYPLDQVRHM 1798
            .||..|:|:...||...|.||:::..|:|..|:|:|||.|.|::.:.:::.... ...|..||..
plant   370 AEIRILKKLVCSDPENKHHCVRLLSTFEYRNHLCLVFESLHLNLREVVKKIGVNIGLKLYDVRVY 434

  Fly  1799 AYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDH 1863
            |.||..|:|.|.:..:.|.|:||:|||.              .|.|.:    ::|.|||||.|..
plant   435 AEQLFISLKHLKNCGVLHCDIKPDNILM--------------NEGRNM----LKLCDFGSAMFAG 481

  Fly  1864 EHHST--IVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILG 1926
            |:..|  :|| |.|||||:||.|.:..|.|:||:||.|:|||.|..:|....|.:.|.:...:.|
plant   482 ENQVTPYLVS-RFYRAPEIILGLPYDHPLDIWSVGCCLYELYSGKIMFPGSTNNDMLRLHMELKG 545

  Fly  1927 QIPYRMARNHTLYSK--TKTKYFYHGKLDWDEKSSAGRYVRD---HCKPLFLCQL----SDSEDH 1982
            ..|.:|.|......:  .|...||    ..:|.|..|:.:|.   :.||..|..:    .:.||.
plant   546 PFPKKMLRKGAFIDQHFDKDLCFY----ATEEDSVTGKTIRRIMVNVKPKDLGSVIRRRYEDEDP 606

  Fly  1983 CELF---SLIKKMLEYEPSSRITLGEALHHPF 2011
            ..|.   :|:.|:...:|..|:|:.:||.|||
plant   607 KVLVHFRNLLDKIFTLDPQKRLTVSQALAHPF 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 119/352 (34%)
S_TKc 1692..2012 CDD:214567 115/339 (34%)
AT3G53640NP_190932.1 U79_P34 <75..130 CDD:281109
STKc_PRP4 322..639 CDD:271037 116/340 (34%)
S_TKc 323..639 CDD:214567 115/339 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.