DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and FC1

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_001030853.1 Gene:FC1 / 824525 AraportID:AT3G53570 Length:467 Species:Arabidopsis thaliana


Alignment Length:534 Identity:194/534 - (36%)
Similarity:274/534 - (51%) Gaps:115/534 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1517 QQQQHQHSSFGVGMMSRNYYN-------MPKQPERKPLQTFD---PYAYPKPNQMQPVKYQQQQQ 1571
            |...::..:..:.|:.....|       :.|:|.::|..|:|   |...|.|             
plant     2 QSSVYRDKASSIAMILETQRNVEFPHRIVDKRPRKRPRLTWDAAPPLLPPPP------------- 53

  Fly  1572 HPHTQFQNASAGGGGGGAAGLQYDPNTNTQLF--YASPASSSSNKQPQQPQQQQQQQQSQLQQSN 1634
             |.|.||           ..|.|.|...:.|.  :..|                           
plant    54 -PPTVFQ-----------PPLYYGPEFASGLVPNFVYP--------------------------- 79

  Fly  1635 SVIFNHSGQQHQPHQQQQNEMSKSALGLHFIETAKPVIQDDADGHLIYHTGDILHHRYKIMATLG 1699
            ::.:|...:|..|                      |...||.|||.::..||.|..||:|::.:|
plant    80 NMFYNGLPRQGSP----------------------PWRPDDKDGHYVFVVGDTLTPRYQILSKMG 122

  Fly  1700 EGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYH 1764
            |||||:|::..|.:....:|:|:|:::.||||||.:||:.|:::.:.|..... ||::.:||||.
plant   123 EGTFGQVLECFDNKNKEVVAIKVIRSINKYREAAMIEIDVLQRLTRHDVGGSR-CVQIRNWFDYR 186

  Fly  1765 GHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDS 1829
            .|:|||||.||.|::||||:|:|..:|:|.||.:..||..||.::||.||.||||||||||.|.|
plant   187 NHICIVFEKLGPSLYDFLRKNSYRSFPIDLVRELGRQLLESVAYMHDLRLIHTDLKPENILLVSS 251

  Fly  1830 DYTSHYNHK-INREVR-------RVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGW 1886
            :|....::| ::|..:       ..|::.::||||||.||:|:.|:.||||||||||||||.:||
plant   252 EYIKIPDYKFLSRPTKDGSYFKNLPKSSAIKLIDFGSTTFEHQDHNYIVSTRHYRAPEVILGVGW 316

  Fly  1887 SQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHG- 1950
            :.|||:|||||||.||..|..|||||:|.||||||||:||.:|..|...   ..:...|||..| 
plant   317 NYPCDLWSIGCILVELCSGEALFQTHENLEHLAMMERVLGPLPPHMVLR---ADRRSEKYFRRGA 378

  Fly  1951 KLDWDEKSSAGRYVRDHCK-----PLFLCQLSDSEDHC--ELFSLIKKMLEYEPSSRITLGEALH 2008
            ||||.|    |...||..|     |.....:....||.  :|..|::.:|.|:|:.|....|||:
plant   379 KLDWPE----GATSRDSLKAVWKLPRLPNLIMQHVDHSAGDLIDLLQGLLRYDPTERFKAREALN 439

  Fly  2009 HPFFDR-----LPP 2017
            ||||.|     :||
plant   440 HPFFTRSREQSIPP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 161/348 (46%)
S_TKc 1692..2012 CDD:214567 156/335 (47%)
FC1NP_001030853.1 PKc_CLK 102..443 CDD:271036 161/348 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 310 1.000 Domainoid score I312
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000672
OrthoInspector 1 1.000 - - otm2828
orthoMCL 1 0.900 - - OOG6_100708
Panther 1 1.100 - - O PTHR45646
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X440
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.