DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and AT3G17750

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_188402.1 Gene:AT3G17750 / 821043 AraportID:AT3G17750 Length:1138 Species:Arabidopsis thaliana


Alignment Length:435 Identity:108/435 - (24%)
Similarity:200/435 - (45%) Gaps:70/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1605 ASPASSSSNKQPQQPQQQQQQQQ----------SQLQQSNSVIFNHSGQQHQPHQQQQNEMSKSA 1659
            :||::.|.:....:..:::.:::          :..:..::::.     |.|..|.|..|.....
plant   736 SSPSALSHSSDTGREHKEEDEEETSHGPEEDPGTSFEDEDAIVV-----QEQVRQIQAQEQDFET 795

  Fly  1660 LGLHFIETA-KPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKII 1723
            ..|..:... :...::|.:.|::.::  ::..||.:...||...|.:.::..|:.....:.:|||
plant   796 FNLKIVHRKNRTGFEEDKNFHVVLNS--VIAGRYHVTEHLGSAAFSKAIQAHDLHTGIDVCVKII 858

  Fly  1724 KNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFL---REN 1785
            ||.:.:.:.:..||..|:.:.|.||...:..:::.|:|.:..|:.||.|:|..::::|.   ||:
plant   859 KNNKDFFDQSLDEIKLLKYVNQHDPADKYHLLRLYDYFYFREHLLIVCELLKANLYEFQKFNRES 923

  Fly  1786 NYEPY-PLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNT 1849
            ..|.| .:.:::.:..|...::.|||...|.|.||||||||                 ::.....
plant   924 GGEVYFTMPRLQSITIQCLEALNFLHGLGLIHCDLKPENIL-----------------IKSYSRC 971

  Fly  1850 DVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDN 1914
            ::::||.||:.|:.:|..:.|.:|.||||||||.|.:.:..|:||:||||.||..|..|||....
plant   972 EIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSP 1036

  Fly  1915 REHLAMMERILGQIPYRM-----------ARNHTLYSKTKTKYFYHGKLDW--DEKSSAGRYVRD 1966
            ...||.:..|:|.|...|           .:||.||.:.:..    ..|::  .:|||..|.:  
plant  1037 ATLLARVIGIIGSIDQEMLAKGRDTCKYFTKNHLLYERNQES----NNLEYLIPKKSSLRRRL-- 1095

  Fly  1967 HCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPF 2011
                    .:.|.    .....:..:|:.:|..|.:..|||.||:
plant  1096 --------PMGDQ----GFIDFVAYLLQVDPKKRPSAFEALKHPW 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 98/350 (28%)
S_TKc 1692..2012 CDD:214567 96/337 (28%)
AT3G17750NP_188402.1 PKc_DYRK_like 827..1129 CDD:271035 96/337 (28%)
S_TKc 827..1129 CDD:214567 96/337 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.