DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and Scamp3

DIOPT Version :10

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_113912.1 Gene:Scamp3 / 65169 RGDID:68351 Length:350 Species:Rattus norvegicus


Alignment Length:110 Identity:28/110 - (25%)
Similarity:51/110 - (46%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1032 PSYMKNLPSLSRSTSNSAILMTQP---RKEPPP--KEPLKAPAPLPAIAAPTV--------GKPS 1083
            |:.:::.||...:|.:    :..|   |::|||  :.|..||||||..:||:|        .:|.
  Rat    24 PAVIQHRPSQQYATLD----VYNPFENREQPPPAYEPPAPAPAPLPPPSAPSVQSSRKLSPAEPK 84

  Fly  1084 GVLKSSSSSCVPSPRCAAAFFRRPQEANNPQQQHHQPLQKPQQVA 1128
            ..  .|.|:...:....|...::.:|.|...::..:..::.|.||
  Rat    85 NY--GSYSTQATAAAATAELLKKQEELNRKAEELDRRERELQHVA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PHA03247 <205..634 CDD:223021
PKc_CLK 1679..2012 CDD:271036
Scamp3NP_113912.1 SCAMP 135..310 CDD:461193
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.