DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and hipk3b

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_001073628.1 Gene:hipk3b / 569156 ZFINID:ZDB-GENE-030131-82 Length:1261 Species:Danio rerio


Alignment Length:422 Identity:128/422 - (30%)
Similarity:203/422 - (48%) Gaps:92/422 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1675 DADGHLIYHTGDI---LHHRYKIMATLGEGTFGRVVK-----VKDMERDYCMALKIIKNVEKYRE 1731
            |.|..|:.|  ::   |.:.|:::..||.||||:|||     .||:     :|:||:||...|..
Zfish   234 DGDYQLVQH--EMLCSLKNTYEVLDFLGRGTFGQVVKCWKRGTKDI-----VAVKILKNHPSYAR 291

  Fly  1732 AAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVR 1796
            ..::|:..|.:::.::.. :|..|:..:.|.:..|.|:|||||..:::|||::|.:.|.||..:|
Zfish   292 QGQIEVGILARLSNENAD-EHNLVRAFECFQHRSHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIR 355

  Fly  1797 HMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATF 1861
            .:..|:..::|.|....|.|.|||||||:.||.          .|:..|||     :||||||: 
Zfish   356 PILQQVATALKKLKGMGLIHADLKPENIMLVDP----------VRQPYRVK-----VIDFGSAS- 404

  Fly  1862 DHEHH------STIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQ---THDNREH 1917
                |      ||.:.:|:|||||:||.|.:.:..|:||:||::.||:||..|:.   ..|...:
Zfish   405 ----HVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEFDQIRY 465

  Fly  1918 LAMMERILGQIPYRMARNHTLYSKTKTKYFYHGKLD-----WDEKSS------AGRYVRDHCKPL 1971
            ::..:.:.|:        |.|...|||..|:..:.|     |..||:      .|...::..|.:
Zfish   466 ISQTQGLPGE--------HLLNVGTKTSRFFCRESDSPYATWRLKSTEEHETETGLKSKEARKYI 522

  Fly  1972 FLC-----------------QLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLP--- 2016
            |.|                 .|::..|..|..:|:||||..:...||...:||.|||.....   
Zfish   523 FSCLDDIAHVNLVMNLEGCDLLAEKVDRAEFVALLKKMLLIDAEERIAPSDALSHPFVTMQHLLD 587

  Fly  2017 -PH-------HRVGEVSNKQPLSSGSSSRERS 2040
             ||       ..:.:|...:|.|..|.||.::
Zfish   588 FPHSNHVKSCFHIMDVCCSRPGSYESHSRTKA 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 117/377 (31%)
S_TKc 1692..2012 CDD:214567 114/361 (32%)
hipk3bNP_001073628.1 STKc_HIPK3 251..580 CDD:271131 114/362 (31%)
S_TKc 252..580 CDD:214567 114/361 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.