DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and Dyrk3

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster


Alignment Length:667 Identity:163/667 - (24%)
Similarity:284/667 - (42%) Gaps:170/667 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1494 PTAL---QFHQQHQQQQHLQQQQQHPQQ-QQHQHSSFGVGMMSRNYYNMPKQPERK---PLQTFD 1551
            ||:|   |....:|...|....|.:.:: .:||:...|:..::|.:..:....:.|   |.|..:
  Fly    42 PTSLPQIQIQMINQNLTHTGIAQNNTEKANRHQYRDSGLQYLTRCFEPLAMLNDSKEDFPTQPSN 106

  Fly  1552 PYA-YPKPNQMQPV----KYQQQQQHPHTQFQNASAGGGGGGAAGLQYDPNTNTQ--------LF 1603
            ..| ||...|:.|:    :..:..|                 |..|   ||..:.        ||
  Fly   107 NIANYPGDIQILPIFDCCEISESIQ-----------------AISL---PNVTSPSKTKDVPGLF 151

  Fly  1604 YASPASSSSNKQPQQPQQQQQQQQSQLQQSNSVIFNH----SGQQ----HQ--------PHQQQQ 1652
            ..:.:.:|.:|...:.:.....::|.:.::::.:|:.    ||||    |:        |.|...
  Fly   152 LRTISENSKSKSEPECESLISVKESSVMENHTFLFHEQIIMSGQQKCELHEKPKVLVVSPQQVMI 216

  Fly  1653 NEMSK----------SALGLHFI---ETAKPVI-------QDDADGHLIYHTGDILHHRYKIMAT 1697
            ..|:|          :...::||   ...:|.:       .|:..|..|:...|.:.:||:::..
  Fly   217 LYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKI 281

  Fly  1698 LGEGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFD 1762
            :|:|:||:|:|..|.:....:||||::|.:::...|:.||..|..:.:.|.:.....:.|.|:|.
  Fly   282 IGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFT 346

  Fly  1763 YHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFV 1827
            :..|.||.||:|.:::::.:::|.::.:.|..||..|:.|...:..|:.|.:.|.|:||||:|  
  Fly   347 FRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVL-- 409

  Fly  1828 DSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDV 1892
                           :::...:.:::|||||:.|:::...|.:.:|.||||||||...:.:..|:
  Fly   410 ---------------LKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDM 459

  Fly  1893 WSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFY--------- 1948
            ||:||||.||..|..||...:..:.||.:..:||     |...:.|.|..::|.|:         
  Fly   460 WSLGCILAELLSGHALFPGENESDQLACIIEVLG-----MPNKNILASSKRSKSFFSPKGYPRYC 519

  Fly  1949 ------------------HGKLDWDEKSSAGRYVRDHCK-PLFLCQLSDSEDHCELFSLIKKMLE 1994
                              .||......|.:.....|.|| ||||             :.|:..||
  Fly   520 TVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFL-------------NFIRGCLE 571

  Fly  1995 YEPSSRITLGEALHHPFFDR---LPPHHR--VGEVS------NKQPL-------------SSGSS 2035
            ::...|:|..|||.||:..|   .||...  .|.||      |:.|:             ||.|:
  Fly   572 WDADKRLTPSEALKHPWLRRRLPRPPSSSSGCGGVSGLCSSRNESPVTGQNRNFAAETTASSTSA 636

  Fly  2036 S-------RERSHSLSR 2045
            :       ||.|||..|
  Fly   637 TSISLTIKRENSHSSLR 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 102/360 (28%)
S_TKc 1692..2012 CDD:214567 99/347 (29%)
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 111/412 (27%)
S_TKc 276..589 CDD:214567 99/347 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.