DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doa and HIPK4

DIOPT Version :9

Sequence 1:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster
Sequence 2:XP_006723099.1 Gene:HIPK4 / 147746 HGNCID:19007 Length:619 Species:Homo sapiens


Alignment Length:393 Identity:118/393 - (30%)
Similarity:181/393 - (46%) Gaps:71/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1692 YKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKYR-EAAKLEINALEKIAQKDPHCDHLCV 1755
            |.|:..||:||||.|.|.........:|:||:|| :.|| ...|.|:..|..:...||...|: :
Human    11 YDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKN-DAYRNRIIKNELKLLHCMRGLDPEEAHV-I 73

  Fly  1756 KMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLK 1820
            :.:::|.......:|||:|..::|:|.:|||:.|.|...:|.:..|:..::..|.:..:.|.|||
Human    74 RFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQVLTALARLKELAIIHADLK 138

  Fly  1821 PENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHH---STIVSTRHYRAPEVIL 1882
            ||||:.||.          .|...|||     :||||||:...|..   ...:.:|.|||||::|
Human   139 PENIMLVDQ----------TRCPFRVK-----VIDFGSASIFSEVRYVKEPYIQSRFYRAPEILL 188

  Fly  1883 ELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYF 1947
            .|.:.:..||||:||::.||:||..|:..::..:.:..:....|     :.:.|.|::..|..:|
Human   189 GLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQG-----LPKPHLLHAACKAHHF 248

  Fly  1948 Y------HGKLDWDEKSSAGRYVRDHCKPL-----FLCQLSDSE--------------------D 1981
            :      .....|..||||........:||     .|..|...|                    :
Human   249 FKRNPHPDAANPWQLKSSADYLAETKVRPLERRKYMLKSLDQIETVNGGSVASRLTFPDREALAE 313

  Fly  1982 HCELFS---LIKKMLEYEPSSRITLGEALHHPF--FDRLPPHHRVGEVSNKQPLSSGSSSRERSH 2041
            |.:|.|   |||:||.:|...||:...||.|||  ..:|...|   |.::...||.      ||:
Human   314 HADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAH---ETTHYYQLSL------RSY 369

  Fly  2042 SLS 2044
            .||
Human   370 RLS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 109/359 (30%)
S_TKc 1692..2012 CDD:214567 109/359 (30%)
HIPK4XP_006723099.1 PKc_like 11..347 CDD:304357 108/357 (30%)
S_TKc 11..347 CDD:214567 108/357 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.