powered by:
Protein Alignment CG33203 and AT2G40710
DIOPT Version :9
Sequence 1: | NP_001138119.2 |
Gene: | CG33203 / 43414 |
FlyBaseID: | FBgn0053203 |
Length: | 500 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181603.1 |
Gene: | AT2G40710 / 818666 |
AraportID: | AT2G40710 |
Length: | 93 |
Species: | Arabidopsis thaliana |
Alignment Length: | 131 |
Identity: | 32/131 - (24%) |
Similarity: | 51/131 - (38%) |
Gaps: | 45/131 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 307 PVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLCFALPFAMRSILTFLRIRGMVGGSHMALSHVY 371
|:|..||| .|...:||..: |:.: :.|::.|
plant 8 PILHKLII-------FWDQPEALHTT-------CYEI------------LMGLLYG--------- 37
Fly 372 LQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDFEWMSTQT 436
||..:.|.||||:|.||..|...:||.:.|||||...::.::|.:...:|...:.
plant 38 ----------LGALVYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAFTHYRAGLVYLKWRDIEG 92
Fly 437 C 437
|
plant 93 C 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33203 | NP_001138119.2 |
HlyIII |
208..421 |
CDD:296067 |
29/113 (26%) |
AT2G40710 | NP_181603.1 |
HlyIII |
<1..78 |
CDD:296067 |
29/114 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1524940at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.