DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and AT2G40710

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_181603.1 Gene:AT2G40710 / 818666 AraportID:AT2G40710 Length:93 Species:Arabidopsis thaliana


Alignment Length:131 Identity:32/131 - (24%)
Similarity:51/131 - (38%) Gaps:45/131 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLCFALPFAMRSILTFLRIRGMVGGSHMALSHVY 371
            |:|..|||       .|...:||..:       |:.:            :.|::.|         
plant     8 PILHKLII-------FWDQPEALHTT-------CYEI------------LMGLLYG--------- 37

  Fly   372 LQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDFEWMSTQT 436
                      ||..:.|.||||:|.||..|...:||.:.|||||...::.::|.:...:|...:.
plant    38 ----------LGALVYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAFTHYRAGLVYLKWRDIEG 92

  Fly   437 C 437
            |
plant    93 C 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 29/113 (26%)
AT2G40710NP_181603.1 HlyIII <1..78 CDD:296067 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.