DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr9

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_940806.2 Gene:Paqr9 / 75552 MGIID:1922802 Length:375 Species:Mus musculus


Alignment Length:357 Identity:76/357 - (21%)
Similarity:122/357 - (34%) Gaps:130/357 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PPAAAA--SVPSSSASNSSSSSSSSGSDGNVVQLLPWQDMP-TYLQFNPYVLRGYRPLQ-TFKGC 203
            |||:.:  |.|:|:::..|..::::      ..||.|.::| .:::.  ::|.|||.|. |.:.|
Mouse    15 PPASTSRRSHPASASAPRSPPAATT------KPLLRWDEVPDDFVEC--FILSGYRRLPCTAQEC 71

  Fly   204 LLSLFYWHNESINILTHAIPIFYILAIVPGLMPWDSGYKFLSFCHVF---GSVAP---------W 256
            |.|:....||::|..||.||:...|:               .||.:|   ||..|         |
Mouse    72 LASVLKPTNETLNFWTHFIPLLLFLS---------------KFCRLFFLGGSDVPFHHPWLLPLW 121

  Fly   257 C--------------------------GSFVYHLFMNIEK---GENV---YYTLLKLDMVGI--- 286
            |                          .:|.|..:.:|..   |..|   ||.|..|.::..   
Mouse   122 CYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPSLSLLDARVM 186

  Fly   287 --WVSQSFG---------------ALPL-----VTATTLCFPPVLKWLIIVSYCVLSLWGLYKAL 329
              :|.|..|               .||:     |..|..|......|                  
Mouse   187 TPYVQQRLGWHVDCTRLIAVYRALVLPVAFVLAVACTVACCKSRTDW------------------ 233

  Fly   330 TASSPWQRR-------LCFALPFAMRSILTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAIG 387
             .|.|:..|       |..|.|..:.|.|..||........|....:.:|        ::.....
Mouse   234 -CSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWL--------VVAAFFN 289

  Fly   388 AMRIPEKWFPGVVDFYLNSHNIMHVLVVVAVY 419
            ..:|||:..||:.|...:||.:.|:...:::|
Mouse   290 VSKIPERIQPGLFDIIGHSHQLFHIFTFLSIY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 56/288 (19%)
Paqr9NP_940806.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 7/23 (30%)
HlyIII 79..318 CDD:296067 55/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.