DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr5

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_083024.1 Gene:Paqr5 / 74090 MGIID:1921340 Length:330 Species:Mus musculus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:121/281 - (43%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 VLRGYR-PLQTFKGCLLSLFYWHNESINILTHAIPIFYILAIVPGLMPWDSGYKFLSFCHV---- 249
            :|.||| |..:...|:||||...||::||.||.:|.::.:            ::|::..:|    
Mouse    24 ILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFV------------WRFMTALYVTDIQ 76

  Fly   250 -----FGSVAPWCGSFVY-------HLFMNIEKGENVYYTLLKLDMVGIWVSQSFGALPLVTATT 302
                 :..:...|.|.||       |.|.::.|........|....|.::   |.|:....:|.|
Mouse    77 NDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLF---SLGSAIAYSAYT 138

  Fly   303 LCFPPVLKWLIIVSY--CVLSLWGLYKAL-TASSPWQR-------RLC-------FALPFAMRSI 350
              ||..   |:..::  |.::|..|...| |..|.:.|       |||       ||.|:...|:
Mouse   139 --FPDA---LVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSL 198

  Fly   351 LTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVLVV 415
            ..|.|:....|.|....:.:|.|..: |:::|.....:..:||:..||..|:..:||.:.||.|:
Mouse   199 PIFYRLFLFPGESSRNEAMLYHQKHM-GMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVI 262

  Fly   416 VAVYSMHKATIKD----FEWM 432
            :|.:...:|.:.|    .||:
Mouse   263 LATHLQMEAILLDKTLRREWL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 59/245 (24%)
Paqr5NP_083024.1 HlyIII 43..269 CDD:281059 59/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.