DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Adipor2

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001342621.1 Gene:Adipor2 / 68465 MGIID:93830 Length:386 Species:Mus musculus


Alignment Length:306 Identity:84/306 - (27%)
Similarity:132/306 - (43%) Gaps:70/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QLLPWQDMPTYLQFNPYVLRGYR-PLQTFKGCLLSLFYWHNESINILTHAIPIFYILAIVPGLMP 236
            :::|...:|.:|:.|.::|.|:| |:.:|:.|..|:|..|.|:.||.||.:...:.|.:  |:. 
Mouse   104 RVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCL--GIF- 165

  Fly   237 WDSGYKF---LSFCH------VFGSV---APWCGSFVYHLFMNIE-KGENVYYTLLKLDMVGI-- 286
                |.|   :||..      |||..   |..|.||.: ||..:. ..|.|.....|||..||  
Mouse   166 ----YMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSW-LFHTVYCHSEGVSRLFSKLDYSGIAL 225

  Fly   287 --------WVSQSFGALPLVTATTLCFP-PVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLCFA 342
                    |:..||          .|.| |...:||::  |||.:     |....|.|.   .||
Mouse   226 LIMGSFVPWLYYSF----------YCNPQPCFIYLIVI--CVLGI-----AAIIVSQWD---MFA 270

  Fly   343 LP---FAMRSILTFLRIRGMVGGSHMALSHVYLQVEVDG----------VSILGGAIGAMRIPEK 394
            .|   .....:...|.:.|::...|..:|..:|:....|          :.|.|.|:.|.||||:
Mouse   271 TPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPER 335

  Fly   395 WFPGVVDFYLNSHNIMHVLVVVAVYSMH---KATIKDFEWMSTQTC 437
            :|||..|.:.:||.:.|:.||...: :|   .:.:::|.:|....|
Mouse   336 FFPGKCDIWFHSHQLFHIFVVAGAF-VHFHGVSNLQEFRFMIGGGC 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 69/249 (28%)
Adipor2NP_001342621.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
HlyIII 140..363 CDD:397239 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.