DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr6

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_017446590.2 Gene:Paqr6 / 681021 RGDID:1584722 Length:358 Species:Rattus norvegicus


Alignment Length:323 Identity:85/323 - (26%)
Similarity:127/323 - (39%) Gaps:76/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QLLPWQDMPTYLQFNPYVLRGYR-PLQTFKGCLLSLFYWHNESINILTHAIPIFY----ILAI-V 231
            |||....:|... :...::.||| |..:...|:||.|...||::||.||.:|.:|    :||: .
  Rat    23 QLLRVHQVPRVF-WEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALGS 86

  Fly   232 PG-------------LMPWDSGYKFLSFC-HVFGSVAPWCGSFVYHLFMNIEKGENVYYTL---- 278
            ||             |:| ...|.|.|.| |.|.|::|......|.|    :.|....|:|    
  Rat    87 PGFHAEPYHLPLLVFLLP-TCLYPFASCCAHTFSSMSPRARHICYFL----DYGALSLYSLGCAF 146

  Fly   279 --LKLDMVGIWVSQSFGALPLVTA---TTLC--------FPPVLKWLIIVSYCVLSLWGLYKALT 330
              ....|...|:......|.:..|   :.||        ||.            |...||.|.| 
  Rat   147 PYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPE------------LENPGLSKVL- 198

  Fly   331 ASSPWQRRLCFALPFAMRSILTFLRIRGMVGGSH------MALSHVYLQVEVDGVSILGGAIGAM 389
                  |...||.||...::..|.|:|...|.:|      ::.||.|..:    .::|.|.:.|.
  Rat   199 ------RTAAFAYPFLFDNLPLFYRLRLCWGRAHSCGRDALSCSHGYHLL----CALLTGFLFAA 253

  Fly   390 RIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDF----EWMSTQTCHTAANATEQAL 448
            |:||:..||..|:..:||.:.|:..|:..:...:|.:.|.    .|::.|.......||...|
  Rat   254 RLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRGWLAMQEPILGLEATVATL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 67/254 (26%)
Paqr6XP_017446590.2 HlyIII 58..286 CDD:397239 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.