DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and paqr6

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_017207045.1 Gene:paqr6 / 570587 ZFINID:ZDB-GENE-090714-1 Length:402 Species:Danio rerio


Alignment Length:283 Identity:66/283 - (23%)
Similarity:105/283 - (37%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 VLRGYR-PLQTFKGCLLSLFYWHNESINILTHAIPIFYI----------LAIVPGLMPWD----- 238
            ::.||| |..:...|:||.|...||::||.||.:|.:|.          |..|.....|.     
Zfish    94 IMSGYRHPRSSALDCILSSFQMTNETVNIWTHFLPTWYFLWRFSVLCSSLDFVTDSYTWPLLVYM 158

  Fly   239 ---SGYKFLSFC-HVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVSQSFGALPLVT 299
               ..|.|.|.| |.|.:::.......|  |.:        |..|.|..:|..:|....|:|   
Zfish   159 LLICLYPFTSSCAHTFSTMSAEARHICY--FFD--------YGALSLYSLGCAISYGSYAMP--- 210

  Fly   300 ATTLCFPPVLKWL----IIVSYC----VLSLWGLYKALTASSPWQRRL----CFALPFAMRSILT 352
                 ...|..||    :.:..|    ..|:....:.:....|.:.::    .|.:||...|...
Zfish   211 -----DSWVNSWLHQHFVTIGICNSLFCTSMSCYTRFIELQFPHKSKILRTSAFVVPFLFDSFPL 270

  Fly   353 FLRIR----GMVGGSHMALSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVL 413
            |.|:.    |....|....||.|..:    .:.|...:.|..:||:..||..|:..:||.:.|:.
Zfish   271 FYRLLSCCWGSCSPSEALASHSYHLL----FAFLTCFLFASHLPERLAPGRFDYIGHSHQLFHIC 331

  Fly   414 VVVAVYSMHKATIKDF----EWM 432
            .||..:...:|.:.|.    :|:
Zfish   332 AVVGTHFQMEAALSDMASRKDWL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 56/247 (23%)
paqr6XP_017207045.1 HlyIII 113..340 CDD:281059 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.