DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and paqr3b

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001025319.2 Gene:paqr3b / 560764 ZFINID:ZDB-GENE-050913-128 Length:307 Species:Danio rerio


Alignment Length:308 Identity:83/308 - (26%)
Similarity:126/308 - (40%) Gaps:73/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VQLLPWQDMPTYLQFNPYVLRGYRPLQTFKGCLLSLFYWHNESINILTHAIP--IFYILAI--VP 232
            ::|..::.:|.:|:.|||:..|||.....|.||.|:|...||::||.:|.:.  :|:.|.:  :.
Zfish    28 IRLYTYEQIPMFLKENPYITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFSLGVNDMA 92

  Fly   233 GLMPWDSG--------YKFLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVS 289
            .::| .:|        |....||.   .|...| |..||||. ..:.|......|.||..||   
Zfish    93 TVLP-SAGASREDYVIYSIGLFCF---QVCMLC-SVGYHLFC-CHRSEKTCRRWLALDYAGI--- 148

  Fly   290 QSFGALPLVTATTLCFPPVLKWLIIVSYC--------VLSLWGLYKALTA--------SSPWQ-- 336
             |.|.|.       |:.|   .:....||        :|::..|..|:.|        |..|:  
Zfish   149 -SVGILG-------CYVP---GVFYAFYCNSFWRQVYLLTVLALILAVFAAQIHPLYLSQQWKKL 202

  Fly   337 RRLCFALPFAMRSILTFLRIRGMVGGSHM-----ALSHVYLQVEVDGVSILGGAIGA-------M 389
            |.|.|.|..|.          |::...|.     ..|...::|....|.|: ..|.|       .
Zfish   203 RSLMFCLVAAY----------GIIPACHWVWINGGFSSEIVKVFFPRVMIM-YLIAASAFLFYVS 256

  Fly   390 RIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDFEWMSTQTC 437
            :|||::|||.:::...||.:.||||||..|..|:..:....:...|.|
Zfish   257 KIPERYFPGQLNYVGASHQLWHVLVVVMFYWWHQTAVYIMNYRHNQPC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 67/254 (26%)
paqr3bNP_001025319.2 HlyIII 64..283 CDD:281059 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.