DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and PAQR5

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001098024.1 Gene:PAQR5 / 54852 HGNCID:29645 Length:330 Species:Homo sapiens


Alignment Length:281 Identity:74/281 - (26%)
Similarity:112/281 - (39%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 VLRGYR-PLQTFKGCLLSLFYWHNESINILTHAIPI-FYILAIVPGLMPWD---SGYKFLSFCHV 249
            :|.||| |..:...|:||||...||::||.||.:|. |:....|..|...|   ..|.:....::
Human    24 ILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIKNDSYSWPMLVYM 88

  Fly   250 FGSVAPWCGSFVY-------HLFMNIEKGENVYYTLLKLDMVGIWVSQSFGALPLVTATTLCFPP 307
                   |.|.||       |.|.::.|........|....|.::   |.|:....:|.|  ||.
Human    89 -------CTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLF---SLGSAIAYSAYT--FPD 141

  Fly   308 VLKWLIIVSYCVLSLWGLYKAL--------TASSPWQR-------RLC-------FALPFAMRSI 350
            .|.......|        |.||        |..|.:.|       |||       ||.|:...|:
Human   142 ALMCTTFHDY--------YVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSL 198

  Fly   351 LTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVLVV 415
            ..|.|:....|.|....:..|.|..:. :::|...:.:..:||:..||..|:..:||.:.||.|:
Human   199 PIFYRLFLFPGESAQNEATSYHQKHMI-MTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVI 262

  Fly   416 VAVYSMHKATIKD----FEWM 432
            :|.:...:|.:.|    .||:
Human   263 LATHMQMEAILLDKTLRKEWL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 61/245 (25%)
PAQR5NP_001098024.1 HlyIII 43..269 CDD:308575 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.