DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and ADIPOR1

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001277482.1 Gene:ADIPOR1 / 51094 HGNCID:24040 Length:375 Species:Homo sapiens


Alignment Length:281 Identity:86/281 - (30%)
Similarity:127/281 - (45%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QLLPWQDMPTYLQFNPYVLRGYR-PLQTFKGCLLSLFYWHNESINILTHAI--PIFYILAIVPGL 234
            :::|:..:|.:|:.|.|:|.|:| |:.:|:.|..|:|..|.|:.||.||.:  .:|..|.|:..|
Human    93 RVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTML 157

  Fly   235 MPWDSGYKFLSFCH---VFGSV---APWCGSFVYHLFMNIE-KGENVYYTLLKLDMVGI------ 286
            .|   ...|::...   |||..   |..|.||.: ||..:. ..|.|..|..|||..||      
Human   158 RP---NMYFMAPLQEKVVFGMFFLGAVLCLSFSW-LFHTVYCHSEKVSRTFSKLDYSGIALLIMG 218

  Fly   287 ----WVSQSFGALPLVTATTLCFP-PVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLCFALPFA 346
                |:..||          .|.| |.|.:|.||  |||.:..:..|     .|.|   ||.|..
Human   219 SFVPWLYYSF----------YCSPQPRLIYLSIV--CVLGISAIIVA-----QWDR---FATPKH 263

  Fly   347 MRS---ILTFLRIRGMVGGSHMALSHVYLQVEVDG----------VSILGGAIGAMRIPEKWFPG 398
            .::   :...|.:.|:|...|..::..:::....|          :.|.|..:.|.||||::|||
Human   264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPG 328

  Fly   399 VVDFYLNSHNIMHVLVVVAVY 419
            ..|.:..||.|.|||||.|.:
Human   329 KFDIWFQSHQIFHVLVVAAAF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 74/245 (30%)
ADIPOR1NP_001277482.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
HlyIII 129..352 CDD:397239 74/245 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.