DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr8

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001014121.1 Gene:Paqr8 / 316275 RGDID:1311710 Length:354 Species:Rattus norvegicus


Alignment Length:290 Identity:66/290 - (22%)
Similarity:109/290 - (37%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LPWQDMPTYLQFNPYVLRGYRPL-QTFKGCLLSLFYWHNESINILTHAIPIFYILA-----IVPG 233
            :|..|:|...: .||:..||||. ..::....|||..|||.:|:.||.:....:|.     :..|
  Rat    37 VPETDVPQLFR-EPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAG 100

  Fly   234 LMPWDSGYKFLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVSQSFGALP-- 296
            .:.|.|.:.......:..|:.....|.:.||..:  |.|..:||...:|.||:.|.|...||.  
  Rat   101 ALQWASPHTLPLLLFILSSITYLTCSLLAHLLQS--KSELSHYTFYFVDYVGVSVYQYGSALAHF 163

  Fly   297 ---------------LVTATTLCFPPVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLCFALPFA 346
                           .:.|...|     .||.....|    :..|: .....|..|::|..:|..
  Rat   164 FYSSDQAWYERFWLFFLPAAAFC-----GWLSCAGCC----YAKYR-YRRPYPVMRKICQVVPAG 218

  Fly   347 MRSILTFLRIRGMVGGSHMA-----------LSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVV 400
            :..||....:...|...|:|           |..::.        ::.....:..:|||:|||..
  Rat   219 LAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFF--------LVSAYFFSCPVPEKYFPGSC 275

  Fly   401 DFYLNSHNIMHVLVVVAVYSMHKATIKDFE 430
            |...:.|.|.|..:.:...|..:|.:.|::
  Rat   276 DIVGHGHQIFHAFLSICTLSQLEAILLDYQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 52/245 (21%)
Paqr8NP_001014121.1 HlyIII 70..297 CDD:397239 53/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.