DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr9

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001258081.2 Gene:Paqr9 / 315904 RGDID:1311515 Length:373 Species:Rattus norvegicus


Alignment Length:358 Identity:79/358 - (22%)
Similarity:119/358 - (33%) Gaps:128/358 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AEHPPAAAASVPSSSASNSSSSSSSSGSDGNVVQLLPWQDMP-TYLQFNPYVLRGYRPLQ-TFKG 202
            |:.|||     |:|..|:.||...|..: .....||.|.::| .:::.  ::|.|||.|. |.:.
  Rat    12 AKGPPA-----PTSRRSHPSSVPRSPPA-ATTKPLLRWDEVPDDFVEC--FILSGYRRLPCTAQE 68

  Fly   203 CLLSLFYWHNESINILTHAIPIFYILAIVPGLMPWDSGYKFLSFCHVF---GSVAP--------- 255
            ||.|:....||::|..||.||:...|:               .||.:|   ||..|         
  Rat    69 CLASVLKPTNETLNFWTHFIPLLLFLS---------------KFCRLFFLGGSDVPFHHPWLLPL 118

  Fly   256 WC--------------------------GSFVYHLFMNIEK---GENV---YYTLLKLDMVGI-- 286
            ||                          .:|.|..:.:|..   |..|   ||.|..|.::..  
  Rat   119 WCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPSLSLLDARV 183

  Fly   287 ---WVSQSFG---------------ALPL-----VTATTLCFPPVLKWLIIVSYCVLSLWGLYKA 328
               :|.|..|               .||:     |..|..|......|                 
  Rat   184 MTPYVQQRLGWHVDCTRLIAVYRALVLPVAFVLAVACTVACCKSRTDW----------------- 231

  Fly   329 LTASSPWQRR-------LCFALPFAMRSILTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAI 386
              .|.|:..|       |..|.|..:.|.|..||........|....:.:|        ::....
  Rat   232 --CSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWL--------VVAAFF 286

  Fly   387 GAMRIPEKWFPGVVDFYLNSHNIMHVLVVVAVY 419
            ...:|||:..||:.|...:||.:.|:...:::|
  Rat   287 NVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 56/288 (19%)
Paqr9NP_001258081.2 HlyIII 77..316 CDD:413828 55/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.