DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and Paqr7

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_038965971.1 Gene:Paqr7 / 313615 RGDID:1563621 Length:355 Species:Rattus norvegicus


Alignment Length:289 Identity:77/289 - (26%)
Similarity:113/289 - (39%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PWQDMPTY---------LQFNPYVLRGYRPL-QTFKGCLLSLFYWHNESINILTH---AIPIFYI 227
            |.|..|.:         |.:.||:..||||| |.:.....:||..|||::|:.||   |:.:...
  Rat    33 PLQAEPVFTVDRAEVPRLFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALLLR 97

  Fly   228 LAIVPGLMP-WDSGYKFLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVSQS 291
            |.::.|.:. |:..:....|..|..|......|.:.||..  .|.|..:|:...||.||:.|.|.
  Rat    98 LIVLAGSVDFWEDPHALPLFIIVLASFTYLSFSALAHLLQ--AKSEFWHYSFFFLDYVGVAVYQF 160

  Fly   292 FGAL------------PLVTATTLCFPPVLKWLIIVSYCVLSLWGLY--KALTASSPWQR---RL 339
            ..||            ..|.|..|.....|.||    .|..|.:..|  |.......:|.   .|
  Rat   161 GSALAHFYYAIEPSWHDKVQAIFLPTAAFLAWL----SCAGSCYNKYSQKPGLLGRSFQEVPSAL 221

  Fly   340 CFAL---PFAMRSILTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVVD 401
            .:||   |...|.|::.|...     ...||.:...||.   ..:|..|..:..:||.||||...
  Rat   222 AYALDISPVVHRIIVSPLPAE-----EDPALLYHKCQVV---FFLLAAAFFSTVMPESWFPGSCH 278

  Fly   402 FYLNSHNIMHVLVVVAVYSMHKATIKDFE 430
            .:...|.:.||.:|:...:..:|...|::
  Rat   279 IFGQGHQVFHVFLVLCTLAQLEAVTLDYQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 62/236 (26%)
Paqr7XP_038965971.1 HlyIII 75..299 CDD:397239 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.