DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and PAQR7

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_848509.1 Gene:PAQR7 / 164091 HGNCID:23146 Length:346 Species:Homo sapiens


Alignment Length:298 Identity:74/298 - (24%)
Similarity:110/298 - (36%) Gaps:91/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LQFNPYVLRGYRPL-QTFKGCLLSLFYWHNESINILT-------------------------HAI 222
            |.:.||:..||||| ||::....:||..|||::|:.|                         ||:
Human    41 LFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHAL 105

  Fly   223 PIFYILAIVPGLMPWDSGYKFLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIW 287
            |:|.|:.         :.:.:|||            |.:.||..  .|.|..:|:...||.||:.
Human   106 PLFIIVL---------ASFTYLSF------------SALAHLLQ--AKSEFWHYSFFFLDYVGVA 147

  Fly   288 VSQSFGAL------------PLVTATTLCFPPVLKWLIIVSYCVLSLWGLYKALTASSPWQRRLC 340
            |.|...||            ..|.|..|.....|.||..:..|       |...........|.|
Human   148 VYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSC-------YNKYIQKPGLLGRTC 205

  Fly   341 FALPFAMRSILTF-LRIRGMVGGSHM------------ALSHVYLQVEVDGVSILGGAIGAMRIP 392
            ..:|    |:|.: |.|..:|   |.            ||.:...||.   ..:|..|..:..:|
Human   206 QEVP----SVLAYALDISPVV---HRIFVSSDPTTDDPALLYHKCQVV---FFLLAAAFFSTFMP 260

  Fly   393 EKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDFE 430
            |:||||....:...|.:.|:.:|:...:..:|...|:|
Human   261 ERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 60/262 (23%)
PAQR7NP_848509.1 HlyIII 66..290 CDD:281059 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.