DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and PAQR3

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001035292.1 Gene:PAQR3 / 152559 HGNCID:30130 Length:311 Species:Homo sapiens


Alignment Length:316 Identity:74/316 - (23%)
Similarity:123/316 - (38%) Gaps:89/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VQLLPWQDMPTYLQFNPYVLRGYRPLQTFKGCLLSLFYWHNESINILTH--------AIPIFYIL 228
            ::|..::.:|..|:.|||:..|||.....:.|:.|||...||::||.:|        .:.|:.:.
Human    28 IRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMT 92

  Fly   229 AIVPGLMPWDSGYKFLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVSQSFG 293
            :::|........:...|.|.....|...| |..|||| :..:.|......:.||..||    |.|
Human    93 SVLPSASASREDFVICSICLFCFQVCMLC-SVGYHLF-SCHRSEKTCRRWMALDYAGI----SIG 151

  Fly   294 ALPLVTATTLCFPPVLKWLIIVSYCVLSLWGLYKALTA-----------------SSPWQRRLCF 341
            .|.       |:   :..:....|| .:.|.....:|.                 :..|||    
Human   152 ILG-------CY---VSGVFYAFYC-NNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQR---- 201

  Fly   342 ALPFAMRSILTFLRIRGMVGGSHMALSHVYLQVEVDGVSILGGAIGA------------------ 388
                 :|||: |..:.|.  |....|..|:          |.|.|||                  
Human   202 -----LRSII-FCSVSGY--GVIPTLHWVW----------LNGGIGAPIVQDFAPRVIVMYMIAL 248

  Fly   389 -------MRIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIKDFEWMSTQTC 437
                   .::||::|||.:::..:||.|.|:|.||.:|..|::|:...::..::.|
Human   249 LAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 59/262 (23%)
PAQR3NP_001035292.1 Golgi targeting 61..71 5/9 (56%)
HlyIII 64..283 CDD:308575 56/257 (22%)
Golgi targeting 299..303 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.