DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33203 and PAQR4

DIOPT Version :9

Sequence 1:NP_001138119.2 Gene:CG33203 / 43414 FlyBaseID:FBgn0053203 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_689554.2 Gene:PAQR4 / 124222 HGNCID:26386 Length:273 Species:Homo sapiens


Alignment Length:270 Identity:107/270 - (39%)
Similarity:147/270 - (54%) Gaps:12/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QLLPWQDMPTYLQFNPYVLRGYRPLQTFKGCLLSLFYWHNESINILTHAIPIFYILAIVPGLMPW 237
            :||.|...|.:||||.:||.||||..:..|||.||||.|||..||.||.:.:...|.:||..|||
Human     8 RLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPW 72

  Fly   238 DSGYK--FLSFCHVFGSVAPWCGSFVYHLFMNIEKGENVYYTLLKLDMVGIWVSQSFGALPLVTA 300
            ....|  :|...|....:||..||.:|||||..:.|..||..||.|||.|:.:..:.||||::..
Human    73 GQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHC 137

  Fly   301 TTLCFPPVLKWL---IIVSYCVLSLWGLYKALTASSPWQRRLCFALPFAMRSILTFLRIRGMVGG 362
            |..|.|    ||   .:|.|.|||....::||||.|...|...|....|.|.::...|..|:..|
Human   138 TLACRP----WLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSG 198

  Fly   363 SHMALSHVYLQVEVDGVSILGGAIGAMRIPEKWFPGVVDFYLNSHNIMHVLVVVAVYSMHKATIK 427
            :..:|. .||:  :|.:::|||.:...|:||:|.||..|::.|||.|||:|.|.::..:|...:.
Human   199 APGSLP-CYLR--MDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVP 260

  Fly   428 DFEWMSTQTC 437
            |..|.:...|
Human   261 DLLWAAHHAC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33203NP_001138119.2 HlyIII 208..421 CDD:296067 84/217 (39%)
PAQR4NP_689554.2 HlyIII 43..254 CDD:413828 84/217 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147039
Domainoid 1 1.000 131 1.000 Domainoid score I5191
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22278
Inparanoid 1 1.050 182 1.000 Inparanoid score I3993
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 1 1.000 - - FOG0007110
OrthoInspector 1 1.000 - - oto90175
orthoMCL 1 0.900 - - OOG6_110758
Panther 1 1.100 - - LDO PTHR20855
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5335
SonicParanoid 1 1.000 - - X5199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.