DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl21 and F41C6.4

DIOPT Version :9

Sequence 1:NP_651646.2 Gene:Nepl21 / 43413 FlyBaseID:FBgn0027578 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 / 185599 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans


Alignment Length:286 Identity:57/286 - (19%)
Similarity:91/286 - (31%) Gaps:114/286 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SFMDQKADPCNDFYAFSC--GNYK--------------------------RINSALSMQVVTTGV 93
            :.:||.:|||:|||..:|  |:|.                          :|..||:.  :..|.
 Worm    27 NLIDQSSDPCDDFYRHACPVGDYDFLVLMKYAPIFKELETSQEESAWENLKIEEALNN--IKPGE 89

  Fly    94 FET-LTKGLNRKILKMLNTPHDSHDT---------PEDIKVKHFYESCL---------------- 132
            .|. ::....|..|.|......:..|         ..::..|...|:||                
 Worm    90 IENEISAYFERVFLDMCQNNDPAMTTFLLRTQQMLSHEMSTKCRAENCLLRLGGDSNCTRAANDF 154

  Fly   133 ----QIKELNSTYSEKLKRLIAEFGTMPLLEGSSWQEDDFDWLNTTARM------AYRYGITPIF 187
                ..|..:|.|.|.:.:|               :|:...|.|.|..:      .::.|:..|.
 Worm   155 KSRVAKKTDSSHYQEYVLKL---------------RENIAGWKNKTRAVNILLDGNFKVGVDNIN 204

  Fly   188 G------------IEVNKDLASNTRNRIYLGQQDFP----------LE--ARSMYVDDATAVYRQ 228
            .            |:|.|.:|.|....|.   |:.|          ||  ||.::|.|.   |..
 Worm   205 SFLMNMVDVLLQWIQVYKYIAKNPFELIL---QETPWVNDQKINRALEAVARDLFVIDE---YGI 263

  Fly   229 KYRNNIQRIL---QRYLGVKMDLAKK 251
            :.|.||..::   |.:|....|.:.|
 Worm   264 QLRENIDALMKTEQDFLKCSADFSGK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl21NP_651646.2 PepO 57..707 CDD:226118 57/286 (20%)
M13 63..704 CDD:189000 55/280 (20%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.