DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl20 and CG32762

DIOPT Version :9

Sequence 1:NP_651645.1 Gene:Nepl20 / 43412 FlyBaseID:FBgn0039613 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster


Alignment Length:32 Identity:10/32 - (31%)
Similarity:16/32 - (50%) Gaps:5/32 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 QNTDCVENLRQVQMLQAKQMRQLYHQ-PAKPL 477
            ::.||    |.|:...|...|..|:. ||:|:
  Fly    90 RDIDC----RNVRGTGAANRRPCYNPCPARPV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl20NP_651645.1 PepO 50..691 CDD:226118 10/32 (31%)
M13 56..697 CDD:189000 10/32 (31%)
CG32762NP_001284894.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.