DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl18 and maea-1

DIOPT Version :9

Sequence 1:NP_651643.1 Gene:Nepl18 / 43410 FlyBaseID:FBgn0039611 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_493416.1 Gene:maea-1 / 173248 WormBaseID:WBGene00012366 Length:428 Species:Caenorhabditis elegans


Alignment Length:356 Identity:70/356 - (19%)
Similarity:112/356 - (31%) Gaps:124/356 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 ESTKKYFGKLAEHAVYKRYRNPDV-ESEVHKIWDQIKGIFRQRLLGDKLDWISNATRTLAIEKLE 410
            ||.:::|..|.......|.....: :||:.:: |:|  ..|...:.::.:...::......||||
 Worm    88 ESLRRHFDLLIRQVQEARKTVERITQSEIEQL-DKI--TTRADRIHEEFEVTRDSENPRNTEKLE 149

  Fly   411 RM--------HLNINSY-----------------DEENFENVYG--EVFIDRLNYVSNVQQLL-- 446
            |.        |:....|                 |.:.|||:|.  :..:|     .|:|..|  
 Worm   150 RQKFCRFIVWHMLRCGYIEPAKVLVKEMELEDLVDVDVFENMYAVQQALLD-----GNIQPCLAW 209

  Fly   447 ----------IAKGIRFVARINQPADSVDATELLGFTPAYNIQENNITIPVALLQPRYFWGDQYP 501
                      :...|..|||..:....::    ||..|...........|:|        ..::.
 Worm   210 CDRHHRKLRKLESRIELVARQQEAVTLIE----LGNIPEAVAYVKKYIAPIA--------KGKFT 262

  Fly   502 EALKYATLGYL--------LAHEMLHGFDDDGRQYDASGNLAPWWDLKSRYE------FEERRKC 552
            |.|| .|:|.:        |.:..||..|                    ||:      .||..:.
 Worm   263 EDLK-KTMGAIACTLEQSRLRNPELHAAD--------------------RYQKCAALFIEEAHRI 306

  Fly   553 FQ-------AQYHEYQYGGSKLPESKDQSENIADSGGLKLAYAAYELWLGQQSEEVLQRETMEGL 610
            |:       |...:|.....|.|...:..:...|.  .|......::|           ...|.|
 Worm   307 FEIHGNTALATLIQYGLATQKTPSCHNDEKTPLDK--QKCIVCRPDVW-----------PIAENL 358

  Fly   611 PF----NSRQLFFLGYAQLLCDD---VQFLF 634
            |:    |||  .|...:..||||   :.|||
 Worm   359 PYSHVANSR--IFCSLSGKLCDDDKNIPFLF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl18NP_651643.1 PepO 54..682 CDD:226118 70/356 (20%)
M13 58..679 CDD:189000 70/356 (20%)
maea-1NP_493416.1 LisH 149..181 CDD:128913 4/31 (13%)
CLTH 187..330 CDD:287564 34/180 (19%)
CTLH 187..244 CDD:128914 14/65 (22%)
CRA 240..335 CDD:214806 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.