DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl17 and nep-15

DIOPT Version :9

Sequence 1:NP_651641.1 Gene:Nepl17 / 43408 FlyBaseID:FBgn0039609 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001257056.2 Gene:nep-15 / 185513 WormBaseID:WBGene00018227 Length:267 Species:Caenorhabditis elegans


Alignment Length:238 Identity:58/238 - (24%)
Similarity:99/238 - (41%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 YYYHGVTATPIYETETNLVVLPVSYM-------QHRYLWDDIYPAALKYGTLGFTMAHEMAHGFD 523
            :|.|..:    :::..||:...:..:       |....|:.|   .|..|..||::.||:.|.|.
 Worm    42 FYRHACS----FDSPRNLMATALKNLTYELRQKQADLFWNHI---TLVLGFTGFSVGHEIGHSFF 99

  Fly   524 DLNRLYDSRGNLNDNWSTQTKVGFELVKNCLADQFSGMLYGNLRLRRLKSQA-----ESIADN-- 581
            ..:...|.....::|           |:.|:.:||      |......|.::     |.:.||  
 Worm   100 ANHSGTDILPYFSEN-----------VEKCVQNQF------NSTCNEYKEESCVTRNEMLDDNGA 147

  Fly   582 --VGIRIAQSAYWKWLDQVEMEETESLPHMTQSPEQLFFLSAAQFMC----SDIYPERRANFVRN 640
              .|:::|.....|:|.....|..|.| ::||  |||||.|.|...|    |.::.|...::   
 Worm   148 DIFGLQLAYKLMEKYLSGRLEERIERL-NVTQ--EQLFFYSFANQFCSGSLSKVFIEEEGDY--- 206

  Fly   641 NFHPPYEARVFAMMINSPAFAEAFQCSNSSKM--NPPNKCLMY 681
            :.|.....||.| :...|.|.:||.|.::|:|  :...:|::|
 Worm   207 DPHSVNNVRVNA-VAQHPGFRKAFNCPDNSRMMKSATEQCIIY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl17NP_651641.1 PepO 49..672 CDD:226118 55/225 (24%)
M13 55..678 CDD:189000 56/233 (24%)
nep-15NP_001257056.2 GluZincin <87..237 CDD:387391 46/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.