DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WASp and cdc42se1

DIOPT Version :9

Sequence 1:NP_001263045.1 Gene:WASp / 43402 FlyBaseID:FBgn0024273 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001025615.1 Gene:cdc42se1 / 595003 XenbaseID:XB-GENE-945193 Length:79 Species:Xenopus tropicalis


Alignment Length:45 Identity:15/45 - (33%)
Similarity:26/45 - (57%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KDKKRKVTKADISRPTNFVHLSHVG---WDAQKGFDLAGNENDEV 264
            |.|::::.::.|..|.|||||:|:|   ..|..|...||...:::
 Frog    19 KKKRKRIDRSMIGEPMNFVHLTHIGSGDMGASDGLPRAGGVQEQM 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WASpNP_001263045.1 WH1 31..140 CDD:144235
PBD 233..291 CDD:279166 13/35 (37%)
WH2 <433..453 CDD:280384
cdc42se1NP_001025615.1 CRIB 29..>56 CDD:320766 11/26 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..79 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.