DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WASp and Cdc42se1

DIOPT Version :9

Sequence 1:NP_001263045.1 Gene:WASp / 43402 FlyBaseID:FBgn0024273 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001033797.1 Gene:Cdc42se1 / 57912 MGIID:1889510 Length:80 Species:Mus musculus


Alignment Length:45 Identity:15/45 - (33%)
Similarity:25/45 - (55%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KDKKRKVTKADISRPTNFVHLSHVG---WDAQKGFDLAGNENDEV 264
            |.|:|::.:..|..|.|||||:|:|   ..|..|..:.|...:::
Mouse    19 KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQM 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WASpNP_001263045.1 WH1 31..140 CDD:144235
PBD 233..291 CDD:279166 12/35 (34%)
WH2 <433..453 CDD:280384
Cdc42se1NP_001033797.1 CRIB 29..67 CDD:350906 12/35 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..80 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.