DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WASp and vrp1

DIOPT Version :9

Sequence 1:NP_001263045.1 Gene:WASp / 43402 FlyBaseID:FBgn0024273 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001342958.1 Gene:vrp1 / 2540100 PomBaseID:SPBC13E7.09 Length:309 Species:Schizosaccharomyces pombe


Alignment Length:287 Identity:80/287 - (27%)
Similarity:100/287 - (34%) Gaps:93/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PARPPPMQGGLSSTDGVQLRNNKINSVTLTPAPAPAQS----------KNFLSSSFGLGNNAKDK 225
            ||.|||                       .||||||.:          ::.|.:|...|.    |
pombe     3 PAPPPP-----------------------PPAPAPAAAAPAPPLMTGDRSALLNSIQKGK----K 40

  Fly   226 KRKVTKADISRPTNFVHLSHVGWDAQKGFDLAGNENDEVLNEFF---VKAGVSEVELKDRDTRAF 287
            .:|.|..|.|.|.             .|..:.|.........|.   |..|...:.         
pombe    41 LKKATTNDRSAPV-------------VGGGVVGERKSNTPKSFAAPPVPTGAPSLP--------- 83

  Fly   288 IYDFIQSNNVLASVKQYSVESPTET------AAPMPPPVPTRHPSNGNQRTAPPLPPA------- 339
                ..|||.     |.:.|.|:..      |..||   ..||....:...|||..||       
pombe    84 ----TSSNNT-----QQAEERPSMPALGGLFAGGMP---KLRHIGKSSASAAPPSAPAPPTPQSE 136

  Fly   340 -RQP---PPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPP-- 398
             |.|   ||...:..|..|.|||.|::.|||.::.|||...|..|..||..|..|:||||.||  
pombe   137 LRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKV 201

  Fly   399 PPMPVGEIPVITTTHAPTQAARPAAPA 425
            ||.|:.:.||..|:..|:..|.||..|
pombe   202 PPPPLSQAPVANTSSRPSSFAPPAGHA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WASpNP_001263045.1 WH1 31..140 CDD:144235
PBD 233..291 CDD:279166 8/60 (13%)
WH2 <433..453 CDD:280384
vrp1NP_001342958.1 WH2 25..50 CDD:308040 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.