DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WASp and CEL

DIOPT Version :9

Sequence 1:NP_001263045.1 Gene:WASp / 43402 FlyBaseID:FBgn0024273 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens


Alignment Length:449 Identity:110/449 - (24%)
Similarity:149/449 - (33%) Gaps:165/449 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DGHV-----------GLNFVSEEECDSFFRIVDATIETRNRKRQE---------------KRNRQ 154
            |||:           |...|:||:   |:::|.....|:..:..:               :.|::
Human   340 DGHIFASIDMPAINKGNKKVTEED---FYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKK 401

  Fly   155 K-------------------SQQAPNAPLPQVQ----REPARPP--PMQGGLSSTDGVQLRNNKI 194
            |                   :|...||...:..    ..|:|.|  |...|....|.:|....| 
Human   402 KTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGK- 465

  Fly   195 NSVTLTPAPAPAQSKNFLSSSFGLGNNAKDKKRKVTKADISRPTNFVHLS--HVG-------WDA 250
                  |...|.            |...:|  |.|:||.|:..|||....  ::|       |:.
Human   466 ------PFATPT------------GYRPQD--RTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEP 510

  Fly   251 QKGFDLAGNENDEVLNEFFVKAGVSEVE--LKDRDTRAFIYDFIQSNNVLASVKQYSVESPT--E 311
            ..      .||...| |...|.|.|.::  |:....|.:...::....|  :.::.:...||  .
Human   511 YT------TENSGYL-EITKKMGSSSMKRSLRTNFLRYWTLTYLALPTV--TDQEATPVPPTGDS 566

  Fly   312 TAAPMPP-------PVPTRHPSNGNQRTAPPLPPARQ--PPPAVPVTVPGAARAPP------PPN 361
            .|.|:||       |||....|.     |||:||...  .||..|....||...||      ||.
Human   567 EATPVPPTGDSETAPVPPTGDSG-----APPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPV 626

  Fly   362 RP------PPI-----STAPPPPPV---SAPVVAP------PPPPPPPPAAVPPPPP------PP 400
            .|      ||:     |.|||.||.   .||.|.|      ||.||...|..||.||      ||
Human   627 PPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPP 691

  Fly   401 MP----VGEIPVITTTHAPTQAARP----------------AAPAAP--DPRNALMDAI 437
            :|    .|..||..|..:.|....|                |||..|  |.:.|.|.|:
Human   692 VPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAV 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WASpNP_001263045.1 WH1 31..140 CDD:144235 9/34 (26%)
PBD 233..291 CDD:279166 15/68 (22%)
WH2 <433..453 CDD:280384 2/5 (40%)
CELNP_001798.3 Heparin-binding 21..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753 63/201 (31%)
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745 60/190 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.