Sequence 1: | NP_651636.1 | Gene: | CG1647 / 43401 | FlyBaseID: | FBgn0039602 | Length: | 1222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106997.1 | Gene: | ZNF276 / 92822 | HGNCID: | 23330 | Length: | 614 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 48/260 - (18%) |
---|---|---|---|
Similarity: | 87/260 - (33%) | Gaps: | 71/260 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 ERPISGAVGKRGRKRKGEESWPKNNNVKPQVKKESFV---WHKKQKLQPSQITSL---------- 171
Fly 172 -----------VSKREPEIKDEPAEQDTSLKGPPKKAGRKSICSVCGEKFLSKELADEHKSLVHV 225
Fly 226 PSIPRYICNACNQTHHNQSDIRAHQLWHKLSKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQL 290
Fly 291 LVLDRECPLCKKTFVTNFFYNTHRCAIR--------------KRKCGGCSRTLNTEAAYMRHAPT 341
Fly 342 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1647 | NP_651636.1 | zf-AD | 19..99 | CDD:285071 | |
C2H2 Zn finger | 203..224 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 297..314 | CDD:275368 | 4/16 (25%) | ||
ZNF276 | NP_001106997.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | ||
zf-AD | 79..155 | CDD:285071 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..420 | 9/40 (23%) | |||
C2H2 Zn finger | 470..490 | CDD:275368 | 4/36 (11%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 556..573 | CDD:275368 | 4/16 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 583..614 | 4/30 (13%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24406 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |