| Sequence 1: | NP_651636.1 | Gene: | CG1647 / 43401 | FlyBaseID: | FBgn0039602 | Length: | 1222 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001077425.1 | Gene: | ZNF655 / 79027 | HGNCID: | 30899 | Length: | 526 | Species: | Homo sapiens |
| Alignment Length: | 207 | Identity: | 52/207 - (25%) |
|---|---|---|---|
| Similarity: | 83/207 - (40%) | Gaps: | 21/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 150 VKKESFVWHKKQKL-QPSQITSLVSKREPEIK-------DEPAEQDTSLKGPPKKAGRKSICSVC 206
Fly 207 GEKFLSKELADEHKSLVHV---PSIPR----YICNACNQTHHNQSDIRAHQLWHKLSKTPYKCPL 264
Fly 265 CESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHR---CAIRKRKCGGCS 326
Fly 327 RTLNTEAAYMRH 338 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1647 | NP_651636.1 | zf-AD | 19..99 | CDD:285071 | |
| C2H2 Zn finger | 203..224 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 262..282 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 297..314 | CDD:275368 | 2/16 (13%) | ||
| ZNF655 | NP_001077425.1 | COG5048 | 220..>325 | CDD:227381 | 32/105 (30%) |
| C2H2 Zn finger | 222..241 | CDD:275368 | 4/18 (22%) | ||
| C2H2 Zn finger | 249..269 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 277..297 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 305..360 | CDD:275368 | 9/52 (17%) | ||
| C2H2 Zn finger | 367..387 | CDD:275368 | |||
| C2H2 Zn finger | 417..437 | CDD:275368 | |||
| zf-H2C2_2 | 429..454 | CDD:404364 | |||
| C2H2 Zn finger | 445..465 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5489 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||