DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and Zfp655

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_082574.1 Gene:Zfp655 / 72611 MGIID:1919861 Length:541 Species:Mus musculus


Alignment Length:677 Identity:116/677 - (17%)
Similarity:203/677 - (29%) Gaps:251/677 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKVPILLPNEEDTIDLDEPRMSQKIYELVGFTVSVDDKMPQTICSQCVDKINDFYEFREMCYATN 93
            |..||..|:     .:.|.....::::|       :.|..:.|...|.|.     |.||      
Mouse    45 GGFPISKPD-----GISEREQDLQVFDL-------ESKNREVIRGDCSDG-----ETRE------ 86

  Fly    94 KQTRNLLGLKQIEPARLIDLKRIVKEERPISGAVGKRGR-------KRKGEESWPKNNNVKPQVK 151
                        |...||..::|.:|.......|||..:       .|:..:|..:...::..::
Mouse    87 ------------ENKLLIPKRKISEEVHSYKVRVGKFKQDIAQVPETREVYKSEDRLERLQEILR 139

  Fly   152 KESFV-------------WHKKQKLQPSQITSLVSKREPEIK------DEPAEQDTSLKGPPKKA 197
            |..|:             :..::..:|.:..||.|..:.:.:      .:.::.|.:....|...
Mouse   140 KFLFLEREFRQITISKKTFSSEKNTEPEKSFSLDSTLDTDQRVLRIQTTDDSKYDMNFNQNPAVG 204

  Fly   198 GRKSICSVCGEKFLSKELADEHKSLVH------VPSIPR-YICNACNQTHHNQSDIRAHQLWHKL 255
            .::.|...  |.|.|.:..:....|.|      :|:..| |.|:.|.:|.|..|.:..||..|..
Mouse   205 EQEPINLT--ENFQSTDYKESLMDLSHLNKWESMPTTDRSYKCDTCGKTFHQASALTRHQRIHTR 267

  Fly   256 SKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHR---CAI 317
            .| ||||..||.|.:.:.:.:||.|.||.....:....|:.|....|:...:.....|:   ...
Mouse   268 EK-PYKCKECEKSFSQSSSLSRHKRIHTREKSYKCEASDKSCDAPDKSCSQSSDVLQHKKGHAKA 331

  Fly   318 RKRKCGGCSRTLNTEAAYMRHAPTCPKIYLNHSKHIMPQVVTNEAQMLIKNEIEEELLGLPPATT 382
            :..|||.|.|..:......:|..|                   ...|..|            .|.
Mouse   332 KSYKCGTCERVFSRSVHLTQHQRT-------------------HKDMSCK------------CTV 365

  Fly   383 VPPDFVIDEGMQPVVVLERLSSPLLRSSSGTDQLVAAKSKNSDRVSARNYLKRVDQLLKNTINTL 447
            ...||                                                        .:|.
Mouse   366 CGSDF--------------------------------------------------------CHTS 374

  Fly   448 VSIKHEPEVHINDTGPPRGQAESDPEPERNEEHPSFGDDIQAANDECQECQPETESDKISVAACD 512
            ..::|:...|                .|::.|:           |||            .:|   
Mouse   375 YLVEHQRLHH----------------QEKSYEY-----------DEC------------GLA--- 397

  Fly   513 DIPSVSVKQEPEYDGYEKQTGVKQEPLKLKLKITKNHGKLNSSLID-----------DLDEAGQA 566
                           |.||.|::.:.............:|||.||.           :.:|.|::
Mouse   398 ---------------YVKQQGIRFQEKPYSCNECGKDFRLNSHLIQHQRIHTGEKLHECNECGKS 447

  Fly   567 FGRSSKKKKKRKHKEREKEASNETENCRTESQNQPAIKIKQEPVDYAPEATVMTTIPMTQ--FES 629
            |.::|  ...:.||...||.|.|..|             .:|...::.:.|:...:|:.:  |:.
Mouse   448 FSQTS--CLIQHHKMHRKEKSYEYNN-------------YEESFSHSSDLTLQQEVPIRERVFDC 497

  Fly   630 SL---NESERSEEVDEAMIQSQEDVKP 653
            ..   |.|:|:..:....:.::|  ||
Mouse   498 DAWEENFSQRAHLIQHERVHTKE--KP 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 13/69 (19%)
C2H2 Zn finger 203..224 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..314 CDD:275368 2/16 (13%)
Zfp655NP_082574.1 COG5048 237..>316 CDD:227381 27/79 (34%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
C2H2 Zn finger 301..356 CDD:275368 11/73 (15%)
zf-C2H2 334..356 CDD:395048 7/40 (18%)
C2H2 Zn finger 363..383 CDD:275368 5/75 (7%)
COG5048 400..>468 CDD:227381 17/69 (25%)
C2H2 Zn finger 413..433 CDD:275368 5/19 (26%)
C2H2 Zn finger 441..461 CDD:275368 6/21 (29%)
C2H2 Zn finger 497..517 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5489
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.