DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and Ctcfl

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001342114.1 Gene:Ctcfl / 664799 MGIID:3652571 Length:646 Species:Mus musculus


Alignment Length:435 Identity:91/435 - (20%)
Similarity:148/435 - (34%) Gaps:145/435 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKVP-----ILLPNEEDTIDLD-EPRMSQKIYELVGFTVSVDDKM--PQTICSQCVDKINDFYEF 85
            |.||     :.||:   .:.|| ||::|  :...|  |||:.:::  |:.:     .:|: |:..
Mouse   100 GTVPEAEGILQLPS---VLWLDPEPQLS--LQHCV--TVSIPEELYPPEEL-----QRIH-FHLL 151

  Fly    86 REMCYATNKQTRNLLGLKQIEPARLIDLKRIV---------KEERPISGAVGKRGRKRKGEESWP 141
            ||          |:| :.:..|....||....         |::.|..|...||..:....|..|
Mouse   152 RE----------NVL-MAEENPELTPDLDESTALKKPEEDEKDQLPPQGETDKREERLLLLEMKP 205

  Fly   142 KNNNVKPQVKKESFVWHKKQKLQPSQITSLVSKREPEIKDEPAEQDTSLKG----PPKKA----- 197
            |..      |.:..|      |..|.: ||..:::|     ||...||:.|    .||:.     
Mouse   206 KEG------KDDEIV------LTISHL-SLEEQQDP-----PAANQTSVPGAKAAKPKRRRQTKG 252

  Fly   198 -----------------------------GRKSICSVCGEKFLSKELADEHKSLVHVPSIPRYIC 233
                                         .|..:|.:|.:.|.:..|...|.: .|..:.| :.|
Mouse   253 KPQSFQCDTCPFTSSKLSTFNRHIKIHSNERPHLCHLCLKAFRTVTLLRNHVN-THTGTRP-HKC 315

  Fly   234 NACNQTHHNQSDIRAHQLWHKLSKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQL-------- 290
            ..|:.......::..|:.:....:.|:||.||:.:...|....||:|.||...|.|.        
Mouse   316 RDCDMAFVTSGELVRHRRYKHTYEKPFKCSLCKYASVEASKMKRHIRSHTGERPFQCCQCAYASR 380

  Fly   291 --LVLDR-----------ECPLCKKTFVTNFFYNTHRCA-----IRKRKCGGCS----------- 326
              ..|.|           |||.|...|..:.....|...     :.|.:|..|:           
Mouse   381 DSYKLKRHMRTHSGEKPYECPTCHVRFTQSGTMKIHIAQKHGENVPKYECPHCATIIARKSDLRV 445

  Fly   327 --RTLNTEAAYMRHAPTCPKIYLNHSKHIMPQVVTNEAQMLIKNE 369
              |.|::::........||..:  |.::.:.|     .|...|||
Mouse   446 HLRNLHSQSPEEMKCRYCPAGF--HERYALIQ-----HQRTHKNE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 19/77 (25%)
C2H2 Zn finger 203..224 CDD:275368 5/20 (25%)
C2H2 Zn finger 233..253 CDD:275368 3/19 (16%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..314 CDD:275368 4/16 (25%)
CtcflNP_001342114.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..195 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..257 9/39 (23%)
COG5048 <256..491 CDD:227381 45/237 (19%)
C2H2 Zn finger 259..279 CDD:275368 0/19 (0%)
C2H2 Zn finger 287..307 CDD:275368 5/20 (25%)
C2H2 Zn finger 315..333 CDD:275368 3/17 (18%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
C2H2 Zn finger 372..392 CDD:275368 2/19 (11%)
C2H2 Zn finger 400..417 CDD:275368 4/16 (25%)
C2H2 Zn finger 460..480 CDD:275368 5/26 (19%)
C2H2 Zn finger 488..508 CDD:275368
C2H2 Zn finger 516..534 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.