DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and ZIPIC

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:454 Identity:85/454 - (18%)
Similarity:147/454 - (32%) Gaps:157/454 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CTICRLCGIDNPGKVPILLPNE--EDTIDLDEPRMSQKIYELVGFTVSVDDKMPQTICSQCVDKI 79
            |.||:.         .:.:|.:  .||:......:|:.:.:....|..|..:...|||.:|.:|:
  Fly     3 CCICQF---------SVRVPKDIHTDTVGHPPVLISELVLQCTRGTNYVLTEESSTICKKCCEKL 58

  Fly    80 NDFY-----------EFREMCYA-----TNKQTR-----------------NLLGLKQ------- 104
            ..::           |..|:.::     .:|||.                 |:...:|       
  Fly    59 ARYHKSIQIARKLRGEILELIHSPYMSKDHKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQE 123

  Fly   105 ----------IEPARLIDLKRIVKEERPI---------------------SGAVGKRGRKRKGEE 138
                      :.||.:::  .:.:||...                     :..:.......:.||
  Fly   124 LESVGTTVTLVGPAGIVE--EVAEEEHTFIIKQSEEEDEFHSVDLELDIDNEIIINEEEAHEVEE 186

  Fly   139 SWPKNNNVKPQVKKESFVWHKKQKLQPSQITSLVSKREPEIKD----------------EPAEQD 187
            ...:...|..::::|..:.|.||:.|.....     :|..:.|                |..|||
  Fly   187 VAHEIEEVAHEIEEEDLLPHDKQEAQEEDFF-----KEDTMSDFDEHLDGAIEYIISDGEDQEQD 246

  Fly   188 TSLKGPPKKAGRKSI---CSVCGEKFLSKELADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAH 249
            .      :.:|..::   |..|.|||.|:...:.|....|.|.   |:|:.|.:|..:.|....|
  Fly   247 N------ESSGEYTVNIQCPSCPEKFSSRRAYNVHTKREHFPG---YVCDQCGKTLQSYSGFIGH 302

  Fly   250 QLWHKLSKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHR 314
            ...|:..| .:.||:|....:..:....|:..|:..||.|       |.:|.|.||       |:
  Fly   303 LQNHEPVK-QFACPVCPERFSRKFRLKHHMAWHSGETPYQ-------CDVCSKRFV-------HK 352

  Fly   315 CAIRKRK-----------CGGCSRTLNTEAAYMRH-----------APTCPKIY---LNHSKHI 353
            .|:.|.|           |..|.....|:|...||           .|.|.|.:   .|...|:
  Fly   353 VALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 18/114 (16%)
C2H2 Zn finger 203..224 CDD:275368 7/20 (35%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
C2H2 Zn finger 297..314 CDD:275368 5/16 (31%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
zf-H2C2_2 327..351 CDD:290200 10/37 (27%)
C2H2 Zn finger 342..391 CDD:275368 15/55 (27%)
zf-H2C2_2 383..408 CDD:290200 5/24 (21%)
C2H2 Zn finger 399..419 CDD:275368 5/18 (28%)
C2H2 Zn finger 432..449 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.