DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and CG14667

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:356 Identity:69/356 - (19%)
Similarity:141/356 - (39%) Gaps:66/356 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLCTICRLCGIDNPGKVPILLPNEEDT---IDLDEPRMSQKIYELVGFTVSVDDKMPQTICSQCV 76
            ||..:||:|.    .|:   :.::.|.   |.:....:.| :..:.|..::.:..:|:.:|.:|.
  Fly     2 NLADVCRICA----NKI---MGHQRDRNIFIHMRGKYLGQ-LKLITGVELTRNQGLPEIVCERCF 58

  Fly    77 DKINDFYEFREMCYATNKQTRNLLGLKQIEPARLIDLKRIVKEERPISGAVGKRGRKRKGEESWP 141
            .:::...:|||.|..:.|...:::.....:....::|.....:|:.|..                
  Fly    59 SELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDA---------------- 107

  Fly   142 KNNNVKPQVKKESFVWHKKQKLQPSQITSLVSKREPEIKDEPA---------------EQDTSLK 191
              :.::.....:.:|.::..|.:...:      .|.|:.|:|:               ::|...:
  Fly   108 --DQLETHYDDDQYVCYQGTKEEHQDL------EEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQ 164

  Fly   192 GPPKKAGRKS---ICSVCG----EKFLSKELADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAH 249
            ...:.|.|:|   ||..||    :.||..|..:.|::...:...  :.|..|.||.:.::.::.|
  Fly   165 EMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQF--FPCPECPQTFNKKALLKQH 227

  Fly   250 QLWHKLSKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTF--VTNFFYNT 312
            :....|....::|.:|..:.|:..|..||.:.|....|...|    ||.:...:.  :.|.| :|
  Fly   228 RTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCL----ECGMIFSSVSELQNHF-ST 287

  Fly   313 HRCAIRKRKCGGCSRTLNTEAAYMRHAPTCP 343
            |...|||.:|..|:....|....:.|..|.|
  Fly   288 HSKQIRKFRCEPCNMDFITRRGLVAHTKTAP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 16/82 (20%)
C2H2 Zn finger 203..224 CDD:275368 7/24 (29%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..314 CDD:275368 4/18 (22%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 16/81 (20%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-C2H2_8 243..313 CDD:292531 20/74 (27%)
C2H2 Zn finger 268..288 CDD:275368 5/24 (21%)
C2H2 Zn finger 297..316 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.