DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and Muc18B

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:275 Identity:56/275 - (20%)
Similarity:90/275 - (32%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   845 LPPLELQNESSRKDLESERMDTE-VSTALP------ASETPSQTRDVLGVEKSEASAFSLVITNI 902
            :||..|...::.|........|| |:||.|      .:|.|..|..:    .:||...:..||..
  Fly    91 IPPSNLDESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTEKI----TTEAPGTTEKITTE 151

  Fly   903 CSQAVPQPSAACSNDIECSIGPSPSTTNEPHSHTVENVQSPANDL-------QTSAQVAIAAQSQ 960
            ......:.:.......|.....:|.||.:|.:......:.||.|.       :|:.......:|.
  Fly   152 APGTTEKITTEAPGTTEKITTEAPGTTEKPATDAPGTTEKPATDAPGTTEKSETTDAPGTTDKSD 216

  Fly   961 PDPCIVSQPAASSESQADTKDLPPAASQIQTFNTESLPIHVHSETEDNSIENDASYLESRAQVDC 1025
            .|..|..:|     |.|:|....|        |||:.     ...|:.:||::.          |
  Fly   217 TDAPITDEP-----STAETSTDEP--------NTETT-----ESGEETTIEDNV----------C 253

  Fly  1026 QSAGTENPSVVLEQNESLPSGSCVSPIPENPSPGNSPPQHDESESLDKPEMAAGSAYCLATVSLD 1090
            .:.|.            .|:|||...|..:.:.|:              |:.|.:..|...:..|
  Fly   254 ATTGL------------FPTGSCTHFIVCSYAEGD--------------ELKAYTKKCPGEMQFD 292

  Fly  1091 APKDTEALALPPCDA 1105
             |.::...|...|.|
  Fly   293 -PFNSVCSASYDCTA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.