DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and Dmp1

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:XP_006250684.1 Gene:Dmp1 / 25312 RGDID:2508 Length:504 Species:Rattus norvegicus


Alignment Length:546 Identity:119/546 - (21%)
Similarity:184/546 - (33%) Gaps:134/546 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   730 SGESAFNMISIKPEPRNLGYGDE---EPEDQRETTEEINHNDMMEEEKEYIGSLDLSDVSVKQER 791
            |.|...|:....|.|.|....:|   .||.|..:    :|.|..|..:| :|| |.|     |.|
  Rat    30 SEERTGNLAQSPPPPMNSESSEESKVSPEGQANS----DHTDSSESGEE-LGS-DRS-----QYR 83

  Fly   792 ELDICEIDAVHRNGLEKS-------DEDDDDGNEDSASSADEAEEAMER--------DTEERIYR 841
            .          ..||.||       :||:||..:|:....|......||        |::|....
  Rat    84 P----------AGGLSKSAGMDADKEEDEDDSGDDTFGDEDNGPGPEERQWGGPSRLDSDEDSAD 138

  Fly   842 EIELPPLELQNESSRKDLESERMDTEVSTALPASETPSQTRDVLGVEKSEASAFSLVITNICSQA 906
            ..:........|:|.:|..|:..|.....|....|....|:|      ||:..:.:   ...|:.
  Rat   139 TTQSSEDSTSQENSAQDTPSDSKDHHSDEADSRPEAGDSTQD------SESEEYRV---GGGSEG 194

  Fly   907 VPQPSAACSNDIECSIGPSPSTTNEPHSHT------VENVQSPANDLQTSAQVAIAAQSQPDPCI 965
            ..........|.|......|.:|.....||      :.:.:|..:...||.|.:..:|.......
  Rat   195 ESSHGDGSEFDDEGMQSDDPGSTRSDRGHTRMSSAGIRSEESKGDHEPTSTQDSDDSQDVEFSSR 259

  Fly   966 VSQPAASSESQADTKDLPPAASQIQTFNTESLPIHVHSETEDNSIENDASYLESRAQVDCQSAGT 1030
            .|...:....:.|..:|..:.|:               ||:.:|.|:..|..|||::....:|.|
  Rat   260 KSFRRSRVSEEDDRGELADSNSR---------------ETQSDSTEDFRSKEESRSETQEDTAET 309

  Fly  1031 ENPSVVLEQNESLPSGSCVSPIPENPSPGNSPPQHDESESL-------------------DKPEM 1076
            ::       .|..|.|.  .|..|:......|.|...|||.                   |:.:.
  Rat   310 QS-------QEDSPEGQ--DPSSESSEEAGEPSQESSSESQEGVASESRGDNPDNTSQTGDQRDS 365

  Fly  1077 AAGSAYCLATVSLDAPKDTEALALPPCDAAIIDSNYTSDEEQQNVLNHELSEQ-----QLAIMEH 1136
            .:.....|.|.|....:.||...    |:...:|...|:|.|::..:.:.|.|     |.|..|.
  Rat   366 ESSEEDRLNTFSSSESQSTEEQG----DSESNESLSLSEESQESAQDEDSSSQEGLQSQSASRES 426

  Fly  1137 RQLLVHEEQPALLEVIPPGLSSRPIEETENRINEQQQDLEQGEERPPRFQANDDSNINEIAENNN 1201
            |......||.:..|              |||.::.|......||      :|...:.:...|:|:
  Rat   427 RSQESQSEQDSRSE--------------ENRDSDSQDSSRSKEE------SNSTGSTSSSEEDNH 471

  Fly  1202 NANIE---RELQDDA-----LGAQEN 1219
            ..|||   |:|..||     :|.|::
  Rat   472 PKNIEADNRKLIVDAYHNKPIGDQDD 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Dmp1XP_006250684.1 DMP1 1..504 CDD:284637 119/546 (22%)
PHA02664 <112..195 CDD:177447 17/91 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.