Sequence 1: | NP_651636.1 | Gene: | CG1647 / 43401 | FlyBaseID: | FBgn0039602 | Length: | 1222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006528028.1 | Gene: | Zfx / 22764 | MGIID: | 99211 | Length: | 832 | Species: | Mus musculus |
Alignment Length: | 289 | Identity: | 63/289 - (21%) |
---|---|---|---|
Similarity: | 98/289 - (33%) | Gaps: | 57/289 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 FREMCYATNKQTRNLLGLKQIEPARLIDLKRIVKEERPISGAVGKRGRKRKGEESWPKNNNVKPQ 149
Fly 150 VKKESFVWHKKQKLQPSQITSLVSKREPEIKDEPAEQDTSLKGPPKKAGRKSICSVCGEKFLSKE 214
Fly 215 LADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAHQLWHKLSKTPYKCPLCESSVANAYAFTRH- 278
Fly 279 LREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHRCAIRKRK---CGGCSRTLNTEAAYMRHAP 340
Fly 341 T------------CPKIYLNHS---KHIM 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1647 | NP_651636.1 | zf-AD | 19..99 | CDD:285071 | 4/13 (31%) |
C2H2 Zn finger | 203..224 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 297..314 | CDD:275368 | 4/16 (25%) | ||
Zfx | XP_006528028.1 | Zfx_Zfy_act | 104..437 | CDD:368066 | |
zf-C2H2 | 452..474 | CDD:333835 | |||
C2H2 Zn finger | 454..474 | CDD:275368 | |||
C2H2 Zn finger | 485..509 | CDD:275368 | |||
C2H2 Zn finger | 517..537 | CDD:275368 | |||
COG5048 | 570..>832 | CDD:227381 | 63/289 (22%) | ||
C2H2 Zn finger | 577..597 | CDD:275368 | 6/27 (22%) | ||
C2H2 Zn finger | 605..624 | CDD:275368 | 5/23 (22%) | ||
C2H2 Zn finger | 662..683 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 691..711 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 748..768 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 776..797 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 805..825 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24406 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |