DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and Zfp692

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001035776.1 Gene:Zfp692 / 103836 MGIID:2144276 Length:531 Species:Mus musculus


Alignment Length:219 Identity:47/219 - (21%)
Similarity:75/219 - (34%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PSQITS-----LVSKREPEIKDE---------PAEQDTSLKGPP-------------KKAGRKSI 202
            |..:||     |...|.|::..|         |..|..|...|.             :||.::.:
Mouse   262 PDALTSDTEVRLELSRTPQVPAELHMTESLESPGSQAQSAPNPTWDEDTAQIGLRRIRKAAKREL 326

  Fly   203 --CSV--CGEKFLSKELADEHKSLVHVPSIPRYIC--NACNQTHHNQSDIRAHQLWHKLSKTPYK 261
              |..  ||..|.:::..:.||...|:.. ..:.|  .||.::.:.:..::.|...|..:: .|.
Mouse   327 MPCDFPGCGRIFSNRQYLNHHKKYQHIHQ-KSFCCPEPACGKSFNFKKHLKEHVKLHSDTR-DYI 389

  Fly   262 CPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHR------CAIRKR 320
            |..|..|...:.....|.|.||...|:|       |.:|..|.......|.||      .|..:.
Mouse   390 CEFCARSFRTSSNLVIHRRIHTGEKPLQ-------CEICGFTCRQKASLNWHRRKHAETAAALRF 447

  Fly   321 KCGGCSRTLNTEAAYMRHAPTCPK 344
            .|..|.:......:.:.|   |.|
Mouse   448 PCEFCGKRFEKPDSVVAH---CSK 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368 6/22 (27%)
C2H2 Zn finger 233..253 CDD:275368 4/21 (19%)
C2H2 Zn finger 262..282 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..314 CDD:275368 4/16 (25%)
Zfp692NP_001035776.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..307 4/19 (21%)
zf-C2H2_8 328..406 CDD:292531 16/79 (20%)
C2H2 Zn finger 360..382 CDD:275368 4/21 (19%)
COG5048 383..>436 CDD:227381 15/60 (25%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 402..427 CDD:290200 9/31 (29%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
C2H2 Zn finger 449..465 CDD:275368 2/15 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.