DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1647 and si:dkeyp-2e4.2

DIOPT Version :9

Sequence 1:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001122042.1 Gene:si:dkeyp-2e4.2 / 100149164 ZFINID:ZDB-GENE-030131-9307 Length:251 Species:Danio rerio


Alignment Length:267 Identity:62/267 - (23%)
Similarity:95/267 - (35%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LKRIVKEERPISGAVGKRGRKRKGEESWPKNNNVKPQVKKES------FVWHKKQKLQPSQITSL 171
            :|.::|.|..:.|          ..||...||:|:..|..::      |....|.:::..| ||.
Zfish     1 MKPVIKNEESLQG----------DPESKSTNNDVETLVLSKTEGSAALFCRRLKYRVKTDQ-TSD 54

  Fly   172 VSKREPEIKDE-PAEQDTSLKGPPKKAGRKSICSVCGEKFLSKELADEHKSLVHVPSIPRYICNA 235
            .|..:.:.:|| |.....:       .|...||.:||.:|.|......|.. :|....| |||..
Zfish    55 QSSSDTDTEDELPISTSPT-------PGEDLICKLCGSEFGSNISMVRHMR-IHTGETP-YICEV 110

  Fly   236 CNQTHHNQSDIRAHQLWHKLSKTP----YKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRE 296
            |.:....|..::.|...|..:|..    ..|..||....::.|...||.:|....|.       .
Zfish   111 CGKGFKRQGWLKEHFRVHTGNKRKREKRLSCDQCEMKFNSSTALRSHLNKHRGERPF-------A 168

  Fly   297 CPLCKKTFVTNFFYNTH--RC-AIRKRKCGGCSRTLNTEAAYMRH-----------APTCPKIYL 347
            |..|.||:......|.|  .| :.:|..|..|......:::..:|           .|.|.|.: 
Zfish   169 CVQCDKTYFNQHDLNQHLRDCHSDKKHGCYLCGNEFTRQSSLQKHMRIHTGERPYSCPHCGKTF- 232

  Fly   348 NHSKHIM 354
             ..||.|
Zfish   233 -SYKHSM 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368 6/20 (30%)
C2H2 Zn finger 233..253 CDD:275368 4/19 (21%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..314 CDD:275368 6/18 (33%)
si:dkeyp-2e4.2NP_001122042.1 C2H2 Zn finger 80..100 CDD:275368 6/20 (30%)
zf-H2C2_2 92..117 CDD:290200 7/26 (27%)
C2H2 Zn finger 108..128 CDD:275368 4/19 (21%)
C2H2 Zn finger 141..161 CDD:275368 6/19 (32%)
C2H2 Zn finger 169..217 CDD:275368 11/47 (23%)
zf-H2C2_2 209..234 CDD:290200 4/26 (15%)
C2H2 Zn finger 225..243 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.