DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and CAF4

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_012962.3 Gene:CAF4 / 853908 SGDID:S000001744 Length:643 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:44/181 - (24%)
Similarity:77/181 - (42%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DNSLMRRIYSSMNMFNSYHANCWPTDAGRTGAIFNLEFNA--------DGNVVVAA--------- 66
            |.:|.|.||...:....      .|:...|..|.|.|.:.        |...:|:.         
Yeast   391 DLNLSREIYLDHSPLKE------KTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHW 449

  Fly    67 --TERKCVLVFDAI---TQKEIFKVPDAHTDSVNC-----------IKFFDERLFATGSDDFTVA 115
              |..||:...|.|   |..:| |:|....::..|           ::.::..| |||:.|..|.
Yeast   450 DLTTGKCIQQLDLIFTPTHSDI-KMPARSLNNGACLLGTEAPMIGALQCYNSAL-ATGTKDGIVR 512

  Fly   116 LWDLRNMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQT 166
            ||||| :.:.:|:|.||::.:.::::.|:.  ||:...|.|:..||:.:.:
Yeast   513 LWDLR-VGKPVRLLEGHTDGITSLKFDSEK--LVTGSMDNSVRIWDLRTSS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 39/157 (25%)
WD40 <45..>218 CDD:225201 38/155 (25%)
WD40 repeat 51..87 CDD:293791 13/57 (23%)
WD40 repeat 95..129 CDD:293791 13/44 (30%)
WD40 repeat 136..174 CDD:293791 7/31 (23%)
WD40 repeat 181..210 CDD:293791
CAF4NP_012962.3 Caf4 65..124 CDD:402971
WD40 318..641 CDD:238121 44/181 (24%)
WD40 repeat 322..360 CDD:293791
WD40 repeat 366..422 CDD:293791 9/36 (25%)
WD40 repeat 427..461 CDD:293791 5/33 (15%)
WD40 repeat 472..526 CDD:293791 15/55 (27%)
WD40 repeat 532..563 CDD:293791 7/31 (23%)
WD40 repeat 571..611 CDD:293791
WD40 repeat 617..641 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.