DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT1G47610

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_175192.1 Gene:AT1G47610 / 841170 AraportID:AT1G47610 Length:351 Species:Arabidopsis thaliana


Alignment Length:286 Identity:58/286 - (20%)
Similarity:116/286 - (40%) Gaps:73/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RESGFHIHR-----------SDDNSLMRRIYSSMNMFNSYHANCWPTDA---GRTGAIFNLEFNA 58
            ||.| ||:.           ||:|.:  |::.::|.|:.:.:|.....|   .|...:|.  .:.
plant    22 REEG-HIYSLAATNDLLYTGSDNNYI--RVWKNLNEFSGFKSNSGLVKAIVISREAKVFT--GHQ 81

  Fly    59 DGNVVVAATERKCVLVFDAI----TQKEIFK---VPD--------------AHTDSVNCIKFF-D 101
            ||.:.|..|..|...|:...    ..|::.|   .|.              .|:|:|:|:... |
plant    82 DGKIRVWKTSSKNPRVYTRAGSLPALKDVLKSSVKPSNYVEVRRCRTALWIKHSDAVSCLSLAED 146

  Fly   102 ERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQT 166
            :.|..:.|.|.||.:|.:.::| .:..:..|.:.|.::  ::.:.|:.:...||::..|      
plant   147 QGLLYSASWDRTVKVWRIHDLK-CIESIKAHDDAVNSV--TTAESLVFTGSADGTVKVW------ 202

  Fly   167 EQGLISQRVFHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLDLTTLHKDLCGFRPGIYRLMQLG 231
            ::.:..:|..|:  |.:..:........|.||        |:.:.:      |...|.....::|
plant   203 KREIRGKRTAHS--LFQTLLKQESAVTALVTS--------HMAVYS------GSSDGAVNFWEMG 251

  Fly   232 EQYIPQAAKYDHVFSKRQKKNRVELV 257
            ::   :..|:..||    ||:|:.::
plant   252 DK---KLLKHCEVF----KKHRLAVL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 40/216 (19%)
WD40 <45..>218 CDD:225201 37/197 (19%)
WD40 repeat 51..87 CDD:293791 9/42 (21%)
WD40 repeat 95..129 CDD:293791 9/34 (26%)
WD40 repeat 136..174 CDD:293791 5/37 (14%)
WD40 repeat 181..210 CDD:293791 5/28 (18%)
AT1G47610NP_175192.1 WD40 24..347 CDD:238121 56/284 (20%)
WD40 repeat 27..60 CDD:293791 7/34 (21%)
WD40 repeat 66..133 CDD:293791 12/68 (18%)
WD40 repeat 138..174 CDD:293791 10/36 (28%)
WD40 repeat 181..216 CDD:293791 6/44 (14%)
WD40 repeat 223..263 CDD:293791 10/60 (17%)
WD40 repeat 269..305 CDD:293791 0/2 (0%)
WD40 repeat 311..346 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.