DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT1G24530

DIOPT Version :10

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_564219.1 Gene:AT1G24530 / 839068 AraportID:AT1G24530 Length:418 Species:Arabidopsis thaliana


Alignment Length:127 Identity:32/127 - (25%)
Similarity:58/127 - (45%) Gaps:17/127 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AIFNLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDA---HTDSVNCIKFFD-ERLFATGSD 110
            |:..|..|.||:|:.:.:..:.:||::.........|..|   |..::  :..|: ..|..:||.
plant   282 AVNALALNDDGSVLFSGSCDRSILVWEREDTSNYMAVRGALRGHDKAI--LSLFNVSDLLLSGSA 344

  Fly   111 DFTVALW----DLRNMKQKLRVLHGHSNWVKNIEYSSKDKL-----LVSSGFDGSIFTWDIN 163
            |.||.:|    |  :....|.||.||:..||::....:.:|     ::|...||.:..|.::
plant   345 DRTVRIWRRGPD--SSYSCLEVLSGHTKPVKSLAAVREKELDDVVSIISGSLDGEVKCWKVS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 <46..>212 CDD:441893 32/127 (25%)
WD40 repeat 51..87 CDD:293791 7/35 (20%)
WD40 repeat 95..129 CDD:293791 10/38 (26%)
WD40 repeat 136..174 CDD:293791 7/33 (21%)
WD40 repeat 181..210 CDD:293791
AT1G24530NP_564219.1 WD40 <79..404 CDD:441893 32/125 (26%)
WD40 repeat 86..124 CDD:293791
WD40 repeat 198..233 CDD:293791
WD40 repeat 239..278 CDD:293791
WD40 repeat 283..323 CDD:293791 9/39 (23%)
WD40 repeat 330..366 CDD:293791 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.