DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT1G24130

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_173823.1 Gene:AT1G24130 / 839025 AraportID:AT1G24130 Length:415 Species:Arabidopsis thaliana


Alignment Length:257 Identity:63/257 - (24%)
Similarity:105/257 - (40%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSLMRRIYSSMNMFNSY-----HANCWPTDAGRTGAIFNLEFNADGNVVVAATERKCVLVFDAIT 79
            |...:.::||    .||     |..|  |......|:.:|..:.||:::.:|:..:...::....
plant   165 NDRFKTLFSS----KSYVEVRRHKKC--TWVHHVDAVSSLALSQDGSLLYSASWDRSFKIWRTSD 223

  Fly    80 QKEIFKVPDAHTDSVNCIKFFDERLFATGSDDFTVALWDLRNMKQKL-RVLHGHSNWVKNIEYSS 143
            .|.:..:..||.|::|.|....:....|||.|..:.:|:.::.|..| ..|..|.:.|..:..|.
plant   224 FKCLDSIEKAHDDAINAIVVSKDGFVYTGSADKKIKVWNKKDKKHSLVATLTKHLSAVNALAISE 288

  Fly   144 KDKLLVSSGFDGSIFTWD--INSQTEQGLISQRVFHAS--GLMRCRISPTGDKLVLCTSGGYIMI 204
            ..|:|.|...|.||..|:  ||...|:       .|.|  |.:|..     .|.::|     :.:
plant   289 DGKVLYSGACDRSILVWERLINGDDEE-------LHMSVVGALRGH-----RKAIMC-----LAV 336

  Fly   205 IHHLDLT-TLHKDLCGFRPGIYRLMQLGEQYIPQAAKYDHVFSKRQKKNRVELVTDFPENND 265
            ...|.|: :..|.|..:|.|   ||: .|.|...|....|.   :..|:....|:|...|:|
plant   337 ASDLVLSGSADKSLRVWRRG---LME-KEGYSCLAVLEGHT---KPVKSLAVSVSDSDSNSD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 48/197 (24%)
WD40 <45..>218 CDD:225201 41/178 (23%)
WD40 repeat 51..87 CDD:293791 5/35 (14%)
WD40 repeat 95..129 CDD:293791 9/34 (26%)
WD40 repeat 136..174 CDD:293791 12/39 (31%)
WD40 repeat 181..210 CDD:293791 4/28 (14%)
AT1G24130NP_173823.1 WD40 <61..415 CDD:225201 63/257 (25%)
WD40 61..409 CDD:238121 63/257 (25%)
WD40 repeat 73..115 CDD:293791
WD40 repeat 120..162 CDD:293791
WD40 repeat 196..231 CDD:293791 5/34 (15%)
WD40 repeat 238..273 CDD:293791 9/34 (26%)
WD40 repeat 281..325 CDD:293791 15/50 (30%)
WD40 repeat 331..353 CDD:293791 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.